KEGG   Trichormus variabilis: Ava_2516Help
Entry
Ava_2516          CDS       T00277                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABA22131
CyanoBase: Ava_2516
CYORF: Ava_2516
UniProt: Q3MA55
Position
3110452..3110775
Genome map
AA seq 107 aa AA seqDB search
MKNIVQKIFSGLATPIKISLAVLLLSTPAVANENSQITGGLIPREPNFFKQGRDLFDREI
YRLLTTNRQTQEAVLKIPHQLSIQEQLFPLEKPQPLPSNYNSPKTNK
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatattgtgcagaaaatattttccggtttagctacacctataaaaatttctcta
gcagttttgctgttaagtacaccagcagtagctaacgaaaattctcagattactggtggt
ttaattcctagagaaccaaacttctttaaacagggaagggatctgtttgatagagaaatc
taccgtttactcacaacaaatcgacagactcaagaagccgttctcaagattccccatcag
ttatcaattcaagaacaattatttcccttggaaaagccccaacccttaccaagtaattat
aatagtcctaaaacaaataaatga

DBGET integrated database retrieval system