KEGG   Trichormus variabilis: Ava_2522Help
Entry
Ava_2522          CDS       T00277                                 

Definition
(GenBank) Protein of unknown function DUF187
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHL10 GHL6 Melibiase GHL13 Glyco_hydro_66 Cellulase-like
Motif
Other DBs
NCBI-ProteinID: ABA22137
CyanoBase: Ava_2522
CYORF: Ava_2522
UniProt: Q3MA49
Position
3118508..3119770
Genome map
AA seq 420 aa AA seqDB search
MTRLAKLFFSYLLFIQLILYLTGLSIPSFSNYEQKSNLPTTTEIRGVWLTNVASGVLFVP
WGINRAIDQLSALNFNTIYPVVWNRGYTFYKSGTAKSVTGADTQPLLNFVHGGQDVLAKI
VALAKPKNLSVIPWFEYGFMAPPDSVIAKRHPEWLTNGQGGVVSISEMLPEESDTDPTNK
LVWLNPLHPEVQQFILSLITEVVTNYHIDGIQIDDHFGMPVQFGYDPYTTELYQKEHQGK
SPPRNHFDGEWMKWRANKITRFMTQVSQVVKEIKPNVKVSLSPNSQAFAYRYYLQDWASW
IKTGLVDELILQVYRNDKSSFVYELEQPAVKLARTQIPVAIGISTGTLRSPVKIEQIREQ
VQAVRDRSFFGISFFYWESLWGYITPESPPYRRQIFQQMFTAKAARPLAPVRESKRQGEG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgactcggttggcaaaattgtttttttcgtacttactgtttatacaattaatattgtat
ttaacaggattatctatcccttcattttctaattatgaacaaaaaagcaatctaccgact
acaacagaaattcgtggagtttggctgactaatgttgctagcggtgtactttttgtaccc
tggggtattaatcgtgctattgaccaactatctgcactaaactttaatacaatttatcct
gtagtttggaacaggggctataccttttataaaagtggtacagctaaatctgttacgggt
gctgatactcaaccgctgctgaattttgtccacgggggacaggatgttttagcaaagata
gttgcacttgctaaaccgaaaaatttaagcgttattccctggtttgaatatggttttatg
gcaccgcccgattcagtgatagcaaaacgacatcctgagtggttaacaaacggtcaaggt
ggagtcgtatctattagtgaaatgttaccagaagaaagcgacaccgaccctacaaataag
ttagtttggctcaatcctttacacccagaggtacagcagtttatcctatcgctaattaca
gaagttgttactaattatcatattgatggcattcaaattgatgatcattttggaatgcca
gtacagtttggctatgatccatatacaactgaactttatcaaaaagaacatcaaggtaaa
agcccccctcgcaatcattttgatggggagtggatgaagtggcgtgctaacaagatcact
cgtttcatgacacaagtttctcaagtagtgaaagagattaaacccaatgttaaggtatct
ctttctcctaattcgcaagcttttgcttacaggtattatttgcaagattgggcaagttgg
ataaaaacaggtttagtggatgaattgattttgcaggtgtatcgcaatgataaaagtagc
tttgtgtacgaattagaacagcctgctgtcaagcttgcgcgtactcaaattcccgtagcg
attggcatatccacaggaactttgcgaagtcctgttaagattgagcaaattagagaacaa
gtacaagctgtacgcgatcgctctttttttggtatctctttcttttactgggaaagtctg
tggggttacatcaccccagaatcacccccataccgccgtcaaatatttcaacaaatgttt
actgctaaagccgctaggccattagcaccagtgagggaaagcaaaaggcagggtgaaggg
taa

DBGET integrated database retrieval system