KEGG   Trichormus variabilis: Ava_2523Help
Entry
Ava_2523          CDS       T00277                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABA22138
CyanoBase: Ava_2523
CYORF: Ava_2523
UniProt: Q3MA48
Position
3119809..3120375
Genome map
AA seq 188 aa AA seqDB search
MKTPLKFILLWTIATFGGFLGSLFWVEVGEQSEIGLVQAAIGGLAIALPQSLILRENISI
FKWVCFTLVAWVLITAIGVGAIGWVVPSGEILPLRLLYGAKIGVVGGLALGIAQCLAIRQ
PILWTWQWILVNSFSWAIAIPIGTTIGFILCRLTHLFLGEVAGLAMTWLVVAILTGINAY
KLDRGVGV
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaccgttaaaatttatcttgctgtggactatagctacttttggtgggtttttg
ggtagtttgttttgggtggaagtgggggaacagtcagagattggccttgtacaagctgct
attggtggattagcgatcgccttacctcaaagtttaattctgcgagaaaatatctctata
ttcaagtgggtttgtttcaccttggttgcttgggtattaattacagctatcggtgtcggc
gcaattggttgggttgtaccctctggggaaattctccctctacgcctcctgtatggggca
aaaatcggtgttgttggcggtctggctttgggaatagcccaatgtttggcaattcgtcag
ccaatcttatggacttggcaatggatattagttaattcttttagttgggcgatcgctatc
cccataggtactactatagggtttatcctctgccgcctcactcacttgtttttaggtgaa
gtcgccggattagctatgacttggcttgtagtagccatcctcacaggtattaacgcctat
aagttggataggggtgtaggggtttaa

DBGET integrated database retrieval system