KEGG   Trichormus variabilis: Ava_2525Help
Entry
Ava_2525          CDS       T00277                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABA22140
CyanoBase: Ava_2525
CYORF: Ava_2525
UniProt: Q3MA46
Position
complement(3123263..3124132)
Genome map
AA seq 289 aa AA seqDB search
MKASAKFDFEDEKFNAPPSQVIPWCQMINPRYGTDGMQHHGLAIKLDNAQAVGFQPDENW
EKVEHEFSSGIETVFISATPRIVIVRRGPLSVKDRETGIKLGTLKENYDAFLADKLKFKT
FTRYLIFLVGENKKFLHESPLQLTLNGAAGASFSKTYCEFQQGKVVSGFVAEIERAYALY
RKQPITPKGPLFHAHGIFCPIIECEERGIEPNTVLVASTVDYEHPSIANLTNYLIASDAP
ESAIICKTFEDYKDFGKEPVRTETPKMAMAGVSSSYIYPDEDDFGYPPY
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatctgctaagttcgactttgaggacgaaaaatttaatgcacccccttctcaa
gtcatcccttggtgtcagatgattaatcctcggtatggcacagatggtatgcagcatcac
ggtttagcgattaagctggataatgctcaagctgtgggttttcagccagatgaaaattgg
gaaaaggtggaacatgagtttagttccggtatcgaaacagttttcattagtgcgactccc
cgaatagtgatagtgcggcgggggcctttgtctgttaaagacagagagactgggatcaaa
ttgggaactttgaaggaaaattatgatgcgtttttggcagataaactcaaatttaaaacc
tttacacgttatctaattttcttggttggtgaaaataaaaagtttctgcatgaatcacca
ctgcaattaaccttaaatggtgcagccggggcaagttttagcaagacttattgtgaattt
caacaaggcaaagtagttagtggctttgtggcggagatagaaagagcttatgctttatac
cgcaagcagccaataacgccgaaggggcctttgttccatgctcacggtattttctgcccg
attattgagtgtgaagaaagaggaattgaaccaaatacagttttggtggcttcgaccgta
gattatgagcatccatcaattgctaatctgactaattacctgatagcttccgacgcgccc
gaatcggcaattatttgtaaaacatttgaagattacaaagattttgggaaggaacctgtc
agaacagaaactccgaaaatggcgatggctggggtttctagttcctatatttatcctgat
gaagatgattttggctatccaccctattaa

DBGET integrated database retrieval system