KEGG   Trichormus variabilis: Ava_2535Help
Entry
Ava_2535          CDS       T00277                                 

Definition
(GenBank) acetyl-CoA carboxylase carboxyltransferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
ava  Trichormus variabilis
Pathway
ava00061  Fatty acid biosynthesis
ava00620  Pyruvate metabolism
ava00640  Propanoate metabolism
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
ava01120  Microbial metabolism in diverse environments
ava01130  Biosynthesis of antibiotics
ava01200  Carbon metabolism
ava01212  Fatty acid metabolism
Module
ava_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ava00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ava_2535
   00640 Propanoate metabolism
    Ava_2535
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Ava_2535
Enzymes [BR:ava01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     Ava_2535
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Ava_2535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans
Motif
Other DBs
NCBI-ProteinID: ABA22150
CyanoBase: Ava_2535
CYORF: Ava_2535
UniProt: Q3MA36
Position
3135469..3136449
Genome map
AA seq 326 aa AA seqDB search
MATTERKPLLLDFEKPLAELANRIDQIRQLAEENGVDVSGEIRKLETRAMQLREEIFSTL
SPSQRLQVARHPRRPSTLDYIQAISDEWMELHGDRCGGDDPALIGGVARLGGKPVVMLGH
QKGRDTKDNIARNFGMATPGGYRKAMRLMEHANKFSMPILTFIDTPGALPTVVAERQGAG
EAIAYNLREMFSLDVPIICTVIGEGGSGGALGIGVGDRLLMFEHSVYTVATPEACAAILW
KDASKSPQAAVALKIVSHDLKNLGIIDQILPEPTGGAHSDPLTAATTLKQALLDNLDELD
RLTSQERRQLRYDKFRKIGVFTEVAH
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctacaactgagcgcaaaccactactgttggattttgaaaagccactagcagaactg
gcaaaccggattgatcaaattcggcaactggcagaggagaatggcgtagatgtgtctggt
gagattcgcaagctagaaacacgcgctatgcaactgcgtgaggaaatttttagtactctg
tctccatctcaacgactacaagtagcacgtcatccccgccgtcctagtaccctcgattac
attcaggccatcagtgatgaatggatggagttacatggcgatcgctgtggtggtgatgat
ccggctcttattggcggcgtagcgcgtttgggtggtaaacctgtggtgatgttaggtcat
caaaaaggacgagataccaaagataatatcgctcgtaattttggcatggcgactccaggc
ggctatcgcaaagctatgcggctgatggaacacgccaacaaatttagtatgccgattttg
acatttatcgatactccaggcgctttacccacagtagtagccgaacgtcaaggtgcaggg
gaagcgatcgcctataatttgcgcgagatgttttctttagatgtaccaattatctgcacc
gttatcggggaaggtggttctggtggtgctttgggtattggtgtaggcgatcgcctatta
atgtttgaacactctgtctatactgtggctacccccgaagcctgtgcggcaattctttgg
aaagatgctagcaagtctccccaagccgccgtcgccctgaaaatcgtctcccatgacctg
aaaaatttgggcatcattgaccagatattacctgaacccacaggtggcgctcattccgac
cctttaacagctgctacaactttaaaacaagccctgttagataacttagatgaactagac
cgcttaacatcacaggaacgccgccaactgcgttatgataagttccgcaaaattggtgta
tttacagaagttgcacattaa

DBGET integrated database retrieval system