KEGG   Trichormus variabilis: Ava_2540Help
Entry
Ava_2540          CDS       T00277                                 

Definition
(GenBank) photosystem I PsaK-like protein
  KO
K02698  photosystem I subunit X
Organism
ava  Trichormus variabilis
Pathway
ava00195  Photosynthesis
ava01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    Ava_2540
Photosynthesis proteins [BR:ava00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Other common subunits
    Ava_2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PSI_PSAK
Motif
Other DBs
NCBI-ProteinID: ABA22155
CyanoBase: Ava_2540
CYORF: Ava_2540
UniProt: Q3MA31
Position
3139658..3139990
Genome map
AA seq 110 aa AA seqDB search
MLLLTNQLNQFIHAGERTMLSSILIAAQATVPNTGTTWNWNGTFIIIASCLLVLLIAGRS
IRYPHVGTKMPLPFPSIFNNPSVATFLASMSFGHIIGVAAVLGLTNLGVI
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgttaactaatcagctaaatcaatttattcatgcaggagaaagaactatgctc
tcatcaatcctcatagcggctcaagccaccgtacccaacacaggtacaacctggaactgg
aatggcacatttattatcatcgctagttgtctattagtgcttttaattgccggcaggtcg
attcgctatccccatgtagggacaaagatgcctttgcccttcccttcaattttcaataat
cccagcgttgccacatttttggcatctatgagttttggtcacattattggcgttgctgcc
gtgttgggattgactaatcttggtgttatttaa

DBGET integrated database retrieval system