KEGG   Trichormus variabilis: Ava_2541Help
Entry
Ava_2541          CDS       T00277                                 

Definition
(GenBank) alkaline phosphatase-like protein
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VPEP
Motif
Other DBs
NCBI-ProteinID: ABA22156
CyanoBase: Ava_2541
CYORF: Ava_2541
UniProt: Q3MA30
Position
3140417..3142195
Genome map
AA seq 592 aa AA seqDB search
MSNKTPPAFISGLWGSFRATNLWHNINKSGISYYIQTMTIQKLIAIIAPSFILLGAMLAP
AEATTLKPIGTYSTGLFEQGGAEIPAYDPVSQRLFVVNGGTSSIDVISISDPTKPSFLFN
IGIQDYGRGVNSVAFKNGLLAAAIEDFTPQNPGKAVFFDVNGNLINSVNVGALPDMLTFT
PDGKRVLVANEGEPNTNYTVDPEGSVSIINIADFSVIHAGFSQFNSQIDQLRAGGVRIFG
PNATVAQDLEPEYITVSPDSTKAWISLQENNAIATLDLITNEITNINPLGFKDHSLPGNG
FDASDRDNAINISNWPVLGMYQPDGIASYTVNGKTYIVTANEGDARDYAGFSEVVRLGSN
QYLLDPTVFPNASVLKNTANLGRLNVTRTLGDENKNGSFEKIYSYGARSFSIWESDQTTG
KLKLVFDSGDQFEQIIAQRLPAFFNSNNTENSFDTRSDDKGPEPEDVKIAKINGRFYAFV
GLERVGGVMVYDITNPAKPVFVDYANNRDFTVPLQNPGGKTNPLAGDLGPEGLLFISAAD
SPNQKPLLITANEISGTTTIYSLDIETVPEPGTMLALGAVVSTTILRVKRKR
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataaaactccgccagccttcatttcaggcttgtggggaagttttcgtgctacg
aatttgtggcacaacatcaacaaatcaggcattagttattatatccaaaccatgactatc
caaaagcttatcgccataatagctccatcttttattctgttaggagcaatgttggctcca
gcagaagcaactaccctcaaaccgataggtacttatagtacaggtctatttgagcagggt
ggtgcagaaattccagcttatgatcctgtaagtcaaaggctatttgtggttaatgggggg
actagtagtattgatgtcatcagtattagtgatccgactaaaccctcattcttgtttaat
atcggtattcaagactacggtagaggggttaatagcgtcgcttttaagaatggcttactg
gccgcagctattgaagatttcacgccccaaaatccgggtaaagctgtattttttgatgtt
aatggcaacttaatcaattctgtaaatgttggagcattgccagatatgctcacttttaca
ccagatggcaaacgtgtcttagtagccaatgaaggtgaaccgaataccaactatacagtt
gatccagaaggctcagttagcattattaatatagctgactttagtgtcatccatgctggt
tttagtcaattcaacagtcaaatcgatcagttacgggcaggtggagtaagaatttttggc
cctaacgctactgttgctcaggatttagagccagagtatataaccgtttcccctgattct
actaaggcttggatatcgttgcaagaaaataatgcgatcgccaccttagacctgattaca
aatgagattaccaatatcaaccctttgggctttaaggatcatagcctgccagggaatggt
tttgatgctagcgatcgcgataatgctattaatatctctaattggcctgtcttgggaatg
tatcaacccgatggcatagcttcctatacagtgaatggcaagacttatattgtcaccgct
aatgaaggtgatgccagggattacgctggtttcagtgaagtagtgcgcctgggtagtaat
cagtatctgcttgatcctacagtgtttccgaatgctagtgttttaaaaaacactgctaat
ttaggtcgtctcaatgtcactagaactttaggcgatgaaaacaaaaatggttcgtttgaa
aagatttactcctatggtgcgcgttctttctctatttgggaatcggatcagactacgggt
aagttaaagttagtgtttgatagtggcgaccaatttgaacaaattattgcccaacgtcta
cccgcgtttttcaactcaaataatactgagaatagttttgatacccgtagcgatgacaaa
gggccagaaccagaagacgtaaagattgccaaaattaacggtcgcttttacgcctttgtt
ggcttggaacgggtgggaggtgtgatggtatatgacattactaacccagccaaacctgtt
tttgtagactatgctaacaatcgtgattttacagttcctttacaaaatccaggtggtaag
actaacccattagccggagatttaggcccagaaggcttactatttatctcagctgctgat
agtcccaatcagaagcctttgttaattaccgccaatgagatcagtggaacaactaccatc
tactctctggatatagaaacagtccctgaacccggaactatgcttgctttaggtgctgtt
gtttcaactaccatcctgagagtaaagcgcaaacgctaa

DBGET integrated database retrieval system