KEGG   Trichormus variabilis: Ava_2543Help
Entry
Ava_2543          CDS       T00277                                 

Definition
(GenBank) Secretion protein HlyD
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 HlyD Biotin_lipoyl_2 PilZ DUF3584 Tropomyosin_1 AAA_13 TMF_TATA_bd
Motif
Other DBs
NCBI-ProteinID: ABA22158
CyanoBase: Ava_2543
CYORF: Ava_2543
UniProt: Q3MA28
Position
3143388..3144803
Genome map
AA seq 471 aa AA seqDB search
MKQQTYPATSQLINTKLQFSGEISAHRQIFPDWQCAKHSLFVACLLSVGVLTASCGSLPK
ETAEAQSQQRRGGERGGVAPVDVAIARRERLETQPEYTGTTTPFRTISLRSQVEARLLAL
NLDVGDTVRRGQNVGQLDDIILSTDLKQAEAELAALESEVARATTQVSNARTQVERARLE
VVQAEADAQRQERLFKEGAISEQAAEQARTQAKTATQALRAATEQVRTEEQAVAAAKGRV
FAQKAVVAQTKERRSYTRLTSPLNGVITERVTEPGNLLQAGGEVLKIADLSQIKVVVQVS
ELELGQIQVGQSVQVRLDAFPDREITGRVTRISPTADATARLIPVEVVIPNSQGNIGSGL
LARVNFASQTPERVVVSQTAIQREGRNQQSAPKTPRQSQNQNGTLYVVTDSQGKPTVTAR
TVTLGKSADGKVEILSGLQPGEQYVARSGRPLKDGENVRLSILSERNPARN
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcaaacttacccagcgacaagccagttaataaatacaaaattacaatttagc
ggtgaaatatctgcccacagacagatatttcctgactggcaatgtgcaaaacatagctta
tttgttgcttgtttgttgagtgtgggtgtactaacagcaagttgcggttctttacccaaa
gaaacagccgaagcccaatctcagcaacgtagaggtggagaacgaggtggggtagcacct
gtagatgtggcgatcgcccgtagagagaggctagagacacaaccagagtatacaggtaca
accacaccatttagaacaatatcgttgcgatcgcaggtagaagccagactcttagctttg
aacttagatgtaggtgacacagttagacgagggcagaacgtcggacaactagatgacatc
atattatccacagacctcaagcaagcagaagccgaactcgcagctttggaatcagaagta
gctagagcgacaacccaggtaagtaatgcccgcacccaagtggaacgggcaagactcgaa
gtagtacaggctgaagcagatgcccaacgtcaagagagattatttaaagaaggagctata
tccgagcaagccgccgagcaagcacggacacaagcaaaaacagctactcaagcactccgc
gcagctactgagcaagtccgaaccgaagaacaagcagttgcggctgccaaaggtagagta
tttgcccaaaaagccgtagttgcccaaacaaaagaacgccgctcatatacacgcctcaca
tccccccttaatggtgtgatcaccgagagagtcacagagccaggtaatctcttacaagct
ggaggagaagttttaaaaattgctgacttgagccaaattaaagtagtagtgcaagtctcc
gaattagaactaggacaaattcaagtcggacaatctgtacaagtacgcttagatgccttc
ccagaccgagaaatcactggtagagtcacccgtatttcccccaccgccgatgctacagct
cgtttaataccagtagaagtagtaattcctaatagtcaaggcaatattggtagtggattg
ctagcaagagttaactttgccagtcaaactccagaacgagtggtagtctcacaaacagcc
attcaaagggaaggcagaaaccagcaatccgccccaaaaaccccaagacaatcacaaaat
caaaacggcacactgtacgtagttacggatagccaaggcaagccaactgtcacagcccgt
acagtcactttaggaaaaagtgctgatggcaaagtagaaattttatctggcttacaacct
ggagagcaatacgtcgcacgtagtggtagacccttaaaagatggggaaaatgtacgtctt
tcaattctttcagagcgaaaccctgcgaggaattaa

DBGET integrated database retrieval system