KEGG   Trichormus variabilis: Ava_2544Help
Entry
Ava_2544          CDS       T00277                                 

Definition
(GenBank) Acriflavin resistance protein
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL
Motif
Other DBs
NCBI-ProteinID: ABA22159
CyanoBase: Ava_2544
CYORF: Ava_2544
UniProt: Q3MA27
Position
3144922..3148185
Genome map
AA seq 1087 aa AA seqDB search
MQQVNKSGGFSISTVSIRQHIGTLMLTLAVMVLGVFFIINLPVDLLPSITYPRIGVRIEA
PGVSPEVAIDEVTRPLEEAFSATEGVVQIFSQTREGQVSLDLFFQPGGNIDQALNDATAA
FNRARNGLPDTIEEPRLFKIDPSQLPVYEFALTSPSLEGLDLRVFAEEELARELGVVPGV
AGVDVSGGVQEEVRVNIDLDRLQALGVGLNDVLDELRNRNVDISGGRILGQNSEPLTRTV
GRFQSADELRNLSFEVSSTASSNPSQQSTVNSQPSTINNRRVYLRDFAQIIDGSEQQRIY
VSLNGEPAVKVSVQKQPDANTINVVDAVKKRLEELRQSSVVPEGTVITPTLDESRFIRNS
ISNVTSSGLIGTALAAIAVLLFLGSLRQTFIIVIAIPLATLAAIILMGLFGLSINVFSLG
GLALGVGIVVDNSIVMLESIAEGVGMTPGKDSKSRLSHKQLIAQAETSSQEVESALVAST
STNLVAVLPFLLIGGFIALLFNELILTITFSVAASIVIAVTVVPMLASRLLGWKFSSGLS
NFWPLRKFNERFEAATRGYGRFLAGILRWRLVTVAIAILLFGGGSLWMAPQIPQQILPRI
STGQASLFAQFPPGTPLETNSKVMSAVDEIIRQQPETEYTFTTAGGALFGTNTNANPLRG
TSTITLKPGTNVDTYVERVTQELNKLNLAGIRLRLAPGQVRGLITNNSPVRNADVDVILQ
GTNADTLQQASRQVLAALEEQATQVRFRPDADERQPEIQILPDWERVSALGLTTRDIGDT
IQTALEGSVPTQLQRGNRLVDVRVQLNESAVQTGSQLQRLPLFVGNNRQVRLSDVAKIVE
AQAPGEIQRINQRQVIIFAGNLTEGASLSRAIEQVNNVISNLELPEGVSVLPSAAAESNR
QLQSSLQLLGGLASFLVFVVMAVQYNSLIDPLVIMFTIPLALAGGIFGLYITNTAIGATV
IVGAVLLVGIVVNNAIIMVELANQIRDRDKVDRRTAILQAAPQRLRPILMTTITTVLGMF
PLALGIGEGSEFLQPLGVVVFSGLSLATLLTLFIIPCFYTLLHDLLSGAWSKPVFIWWRV
WRKRFTL
NT seq 3264 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaagtaaataaaagtggcggatttagtattagtaccgtatcaattcgccaacat
atcggtacactcatgctcaccttagcagttatggtgctgggtgtatttttcattatcaat
ttgcccgtagatttattaccctcaattacctatccccgcattggtgtacgcatagaagca
cctggagtttccccggaggtagcaattgatgaagtgactagacctttggaagaagccttc
tcggcaacagaaggtgtggtacagattttttctcaaactcgtgagggacaagtcagtttg
gatttgttctttcaaccaggaggtaatattgaccaagctctcaatgatgctactgcggct
ttcaacagagcgagaaacggcttaccagacacaattgaagaaccgcgtctgttcaaaatc
gatccttcccagttaccagtatatgaattcgccttaacatccccctccttagaagggcta
gatttacgagtgtttgcagaagaagaactagcccgcgaattgggtgttgttcctggagta
gctggggtagacgtatcgggcggagtgcaagaagaagttagagttaatattgatttagac
cgcttgcaagctttgggtgtaggtttaaatgatgttctagatgaactcagaaaccgcaac
gttgatatttctggtggtcggattttaggacaaaattccgaacctttaacccgtactgtt
ggacgctttcaaagtgccgacgaactcagaaatttgtcctttgaggtctcctcaacagct
tcctcaaatcccagtcaacagtcaacagtcaacagtcaaccatcaaccattaacaaccgc
cgcgtttatctccgggactttgcccaaattatagatggttcagaacaacaacggatatat
gtctcactcaacggtgagccggcagtcaaagtcagtgttcaaaagcaaccagatgctaac
actattaatgttgttgatgctgtaaaaaaacgtttagaagaactgcgacaatctagcgta
gttcctgaaggtaccgtgattacacctaccttagatgaatcgagatttatccgtaactct
atctccaatgttaccagttctggattgataggaacagcattagcggcgatcgctgtcctt
ctcttccttggttccttacgacagacctttattatcgttatcgccatccctctagccacc
ctagccgccatcatcttgatggggttattcggcttatccatcaacgtctttagtttaggt
ggtttagccttgggcgtgggtatagtcgtagacaactccatcgtcatgttggagagcatt
gccgaaggcgtgggcatgactcctggtaaggatagtaaaagcagactcagtcacaagcaa
ctaattgctcaagcagaaaccagcagccaagaagtcgaatcggctctagttgcttctacg
agtacaaacttagtggcagtgttgccgtttttacttattggtggatttatagccttatta
tttaacgaactaattctcaccatcaccttttctgttgccgcttctatcgtcattgctgta
acagttgtgccaatgcttgcttctcgtttattaggctggaaattttccagtggcttgagc
aacttttggccattacgaaaattcaatgagcgttttgaagcagctacgagaggatatggt
agatttttagctggcatcttacgctggcgattagtcacagtagcgatcgccattctcctg
tttggtggtggtagtttatggatggctccccaaattccccaacaaatcctcccccgtatt
agtacaggacaagccagcttattcgctcagttcccacccggcacgcccttagagactaat
agcaaagtcatgagcgcggtggatgaaatcattcggcaacagccagaaacagaatatact
ttcacgactgccggtggtgctttatttggcactaataccaatgctaaccccttacgaggt
accagcaccatcaccctcaaaccaggcactaatgtagatacttatgtcgaacgagttacc
caagaattaaataaactaaatttagcaggtattcgtttacgcttggctcctggtcaagta
cggggtttaattaccaataactctcctgtacgcaatgccgacgttgatgtgattctccag
ggtactaatgcagacacattacaacaagccagccgtcaggtactagcagccttagaagaa
caagccacccaagtgagatttcgtcccgatgctgatgaacgacaaccagaaattcaaatc
ttgcccgactgggaaagagtttctgcattaggactaactactagagatatcggagacaca
attcagaccgccctagaaggcagcgtacccacacaactgcaacgcggcaaccgcttggta
gatgtgcgagtacagttaaatgagtcagcagtacaaacaggttcccaactacaaagacta
cctttatttgttggcaacaatcggcaagttcgcctcagtgatgtcgccaaaattgtcgaa
gcccaagcaccgggagagattcagcgtattaaccaacgccaagttatcatatttgccgga
aatttaactgaaggagctagtttaagtcgcgccatcgaacaggtaaataacgtcattagt
aacctagaattaccggaaggcgtaagtgttttaccaagcgccgccgcagaatccaatcgg
caactacaaagttcactgcaactattaggcggattagctagctttctcgttttcgtcgtc
atggcagtgcagtacaattccctcattgacccgctagtaattatgtttaccattccccta
gcactagcaggcgggattttcggactttacattaccaatactgccattggtgcaaccgtc
atcgtcggtgcagttctattagtgggaattgtcgtcaataatgccatcatcatggtggaa
ttggcaaatcaaatccgcgatcgcgacaaagttgatcgccgcactgccattttgcaagct
gcaccccaacgcttacgtcccatattaatgaccaccattactactgttttagggatgttt
cccctagcattaggaatcggtgaaggctcagaatttctccaaccattgggtgtagtagtg
ttttccggtttatccttagcaacattactcacactattcatcatcccctgcttttacacc
ctactccatgatttattgagtggagcttggagtaagccagtatttatttggtggcgggtt
tggaggaaaaggttcactttgtaa

DBGET integrated database retrieval system