KEGG   Trichormus variabilis: Ava_2546Help
Entry
Ava_2546          CDS       T00277                                 

Definition
(GenBank) hypothetical protein
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABA22161
CyanoBase: Ava_2546
CYORF: Ava_2546
UniProt: Q3MA25
Position
3149699..3150217
Genome map
AA seq 172 aa AA seqDB search
MRKVLLIDTSLLCVWLKVPGKETAGNNKWNFELVNQKIQEESAKSTTLVLPLATIIETGN
HIAQAKTNDSAAKLITARQFANIITYAADETSPWAAFREQIVLWEADELKKLAEQFPNQA
VEKTSMGDASIVLLGWHYHQKGYHVEFLTDDDKLKSQEPPPPSPPTRRSSRR
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaggtattgctcatcgatacatccctgctatgtgtttggttaaaagttccaggt
aaggaaactgctggcaacaataaatggaattttgaacttgtaaatcagaaaattcaggaa
gaaagcgccaagtccactaccttagtgcttcctttagctacgattatcgaaacaggtaac
catatcgcacaagcgaaaacaaacgattcagcagctaaactcataactgctagacaattt
gccaacatcattacttatgcggctgatgaaacaagcccttgggctgctttccgtgagcaa
attgtcctttgggaagcagatgaactcaaaaaactggcggagcaatttcctaatcaagct
gtagaaaaaacttctatgggtgatgctagtatcgttctcttgggctggcattatcaccaa
aaaggctaccatgtggagtttctgactgatgacgacaaactgaaatctcaggaaccaccc
ccaccatcaccacccacacgccgtagtagtcgtcggtaa

DBGET integrated database retrieval system