KEGG   Trichormus variabilis: Ava_2547Help
Entry
Ava_2547          CDS       T00277                                 

Definition
(GenBank) 3-beta hydroxysteroid dehydrogenase/isomerase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ava  Trichormus variabilis
Brite
Enzymes [BR:ava01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     Ava_2547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase NAD_binding_10 3Beta_HSD NmrA GDP_Man_Dehyd NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short KR NAD_binding_2 Glyco_trans_4_2 GSH-S_N
Motif
Other DBs
NCBI-ProteinID: ABA22162
CyanoBase: Ava_2547
CYORF: Ava_2547
UniProt: Q3MA24
Position
complement(3150263..3151267)
Genome map
AA seq 334 aa AA seqDB search
MSGKIAFVTGATGLLGSNLCRALVSQGWQVKGLVRSLDKAKRFLGDSNIELIQGDIEDVP
AFTQALKGVDVVFHTAAFFREYYQPGSDWQKMKRINVDTTIELLQAAEAQGVAKVVFTSS
SGVIQTDPHQAATETAPYNKFAEQNLYFKTKILAEQEIYRFLNTSQIDVVMILPGWMMGP
GDAAPTSAGQLVLDLLAGKLPGVINGGAALTDVRDVATVMVKAAEKGESGGRYIVAGPLT
TMKEIALELEAISGVKAPRMEIPDGMAIAIAWFLEKFTGLTGGVNPMPLAGIQTLLEKAK
LSSAKAERDLGATFRPLRETLKDTVLWYQSQGYV
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaaaatagcttttgtgactggagcaacaggtctgctgggtagtaatctttgc
cgagcgcttgtatctcagggatggcaagtaaaaggtttggttcgttctcttgataaagcc
aaacgtttcctgggagatagcaacattgaactgattcagggtgatattgaagatgtaccc
gcctttactcaggcattaaagggagtagatgtggtgtttcacacggcagctttttttcgg
gagtattaccaaccgggtagtgattggcagaagatgaagcgcattaatgtagataccacg
atagaacttctgcaagcagcagaggcgcagggggtagcaaaggtggtgtttacctcatcc
agtggggtgatccaaactgacccacatcaggcagccacggaaaccgcaccttacaataaa
tttgccgaacagaatctttatttcaaaactaagattttggcagaacaggaaatttaccgc
tttctcaacaccagccaaatagacgtagtgatgattctgcctggttggatgatggggcct
ggagatgctgcaccaacttctgcgggacaactggtgttagacctattggcaggtaaactg
cctggggtaattaatggtggtgctgcattgactgatgtacgggatgtggctacggttatg
gtaaaagctgccgaaaaaggtgaaagcggtgggcgttacatcgtagcggggccactgaca
accatgaaagagattgccttagaactggaagcgatttccggggtcaaagcacctagaatg
gaaattcctgatgggatggcgatcgcgatcgcttggtttttggaaaagttcacaggttta
actggtggagttaaccccatgccactagctggtatccagactttacttgagaaagcaaag
ttaagttcagccaaagccgaacgagatttaggcgcaaccttccgccctttgagggagact
ttgaaagatacggtgttgtggtatcagtctcaaggctatgtataa

DBGET integrated database retrieval system