KEGG   Trichormus variabilis: Ava_2550Help
Entry
Ava_2550          CDS       T00277                                 

Definition
(GenBank) protein translocase subunit secE/sec61 gamma
  KO
K03073  preprotein translocase subunit SecE
Organism
ava  Trichormus variabilis
Pathway
ava02024  Quorum sensing
ava03060  Protein export
ava03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ava00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Ava_2550
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Ava_2550
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Ava_2550
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ava02044]
    Ava_2550
Secretion system [BR:ava02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   Ava_2550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecE
Motif
Other DBs
NCBI-ProteinID: ABA22165
CyanoBase: Ava_2550
CYORF: Ava_2550
UniProt: Q3MA21
Position
3153032..3153253
Genome map
AA seq 73 aa AA seqDB search
MAKKNEAEIAETSGGFNFTNFFQGTKEELEKVVWPSRKQLISESAAVLLMVTLSASLIYL
VDGLFAWVAKQVF
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
gtggccaaaaaaaatgaagcagaaatcgcagagacttctggtgggtttaactttaccaac
ttcttccaaggaacaaaagaagaattagagaaagtagtttggcccagtcgcaagcaacta
ataagtgaatcagcagccgtgttgcttatggtgacactctccgcttccctaatctactta
gtcgatggattgtttgcttgggtagcaaagcaggtattctga

DBGET integrated database retrieval system