KEGG   Trichormus variabilis: Ava_2552Help
Entry
Ava_2552          CDS       T00277                                 

Definition
(GenBank) LSU ribosomal protein L11P
  KO
K02867  large subunit ribosomal protein L11
Organism
ava  Trichormus variabilis
Pathway
ava03010  Ribosome
Module
ava_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ava00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Ava_2552
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ava03011]
    Ava_2552
Ribosome [BR:ava03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Ava_2552
  Bacteria
    Ava_2552
  Archaea
    Ava_2552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11
Motif
Other DBs
NCBI-ProteinID: ABA22167
CyanoBase: Ava_2552
CYORF: Ava_2552
UniProt: Q3MA19
Position
3153893..3154318
Genome map
AA seq 141 aa AA seqDB search
MAKKVVAVIKLALNAGKANPAPPVGPALGQHGVNIMMFCKEYNAKTADQAGMVIPVEISV
YEDRSFTFVLKTPPASVLIRKAAKIERGSNEPNKKKVGTITTAQLREIAQTKLPDLNAND
IDAAMKIVAGTARNMGVTVTD
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaagtagtagcggtcattaaattggccctgaatgctggaaaagccaaccca
gcacccccagttggtcccgccttgggtcaacatggtgttaatatcatgatgttctgcaaa
gagtacaacgccaaaacagccgaccaagctggcatggtgattcctgtagaaatatcggtt
tatgaagaccggagtttcacatttgtactcaaaaccccaccagcatctgtattaatccgt
aaagccgcgaaaattgaaagaggttccaacgaaccgaataagaaaaaagttggcacaatt
accacagcacaactgcgagaaattgcccaaactaaactacctgacctcaacgctaacgac
atagatgcggcaatgaagattgtggcaggaaccgccagaaatatgggtgttacagtcacc
gattag

DBGET integrated database retrieval system