KEGG   Trichormus variabilis: Ava_2554Help
Entry
Ava_2554          CDS       T00277                                 

Definition
(GenBank) LSU ribosomal protein L10P
  KO
K02864  large subunit ribosomal protein L10
Organism
ava  Trichormus variabilis
Pathway
ava03010  Ribosome
Module
ava_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ava00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Ava_2554
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ava03011]
    Ava_2554
Ribosome [BR:ava03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Ava_2554
  Bacteria
    Ava_2554
  Archaea
    Ava_2554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L10 DUF4265
Motif
Other DBs
NCBI-ProteinID: ABA22169
CyanoBase: Ava_2554
CYORF: Ava_2554
UniProt: Q3MA17
Position
3155449..3155994
Genome map
AA seq 181 aa AA seqDB search
MGRTLENKKEIVADLKETLGESTLALVIEYQGLTVAEISDLRRRLRPSGTVCKVTKNTLM
GIAIQDDEKWQPLSELLKGSSAFLLVKEDFSSAIKAYQDFQKVTKKTELRGGVMEGRLLK
EPDVKALGDLPSKEQLMGQIAGAINALATKIAVGINEVPGGLARALQAVADKENGGDDSA
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggtagaacgttagaaaataaaaaggaaattgtagctgacctcaaagaaactttgggt
gagtctactttggcactggtaattgaataccaagggctgacagttgctgaaattagcgac
ttacggcggcggctgcgtcctagtggtactgtctgcaaagtaactaaaaatactttgatg
ggtattgccattcaagatgatgaaaaatggcagcctctgtcggagttgctcaaaggttct
tccgcatttttgctagttaaagaagacttttcttctgcgattaaagcataccaagacttc
caaaaagttaccaagaagacagaacttcgcggtggcgtaatggaagggcgcttgctcaaa
gaaccagatgtcaaagctttaggagacttgccatccaaggaacaactcatgggtcaaatt
gctggagctatcaacgctttggctaccaagattgctgtgggtatcaacgaagttcctggt
ggcttggcgcgggctttgcaagctgtcgctgacaaagaaaatggcggcgatgatagtgct
gcctaa

DBGET integrated database retrieval system