KEGG   Trichormus variabilis: Ava_2561Help
Entry
Ava_2561          CDS       T00277                                 

Definition
(GenBank) Glycosyl transferase, group 1
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_trans_4_2 Glyco_trans_1_2 Glyco_transf_5
Motif
Other DBs
NCBI-ProteinID: ABA22175
CyanoBase: Ava_2561
CYORF: Ava_2561
UniProt: Q3MA11
Position
3161811..3162878
Genome map
AA seq 355 aa AA seqDB search
MKIAQVAPLWERVPPPSYGGIELVVSHLTNELVRRGHEVTLFASGDSQTLAHLETVCPRA
LRLDKNVQDYAAYETLELSQVYQNATEFDIIHSHLGISALPLANLVKTPTVHTLHGHFTK
DNQNVFSHHHQQPYVSISNAQRQIHLNYIKTVYNGIEPKDYPFISQPKEPPYLAFLGRFS
PEKGPHQAIAIAKQSGWRLKMAGKVDIVDAKFFEQEILPHIDGQQIEYLGEINHTEKAEL
LGNAAATLFPINWQEPFGLVMIESMATGTPVIGMNLGSVPEVIDQGKTGFICRTYEEMIQ
MIAVTLELDRRDCRESVVNKFSVSHMVDGYEAVYQQIIKDRVNLNGYIHTAKIRF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgctcaagttgcccccttatgggaacgagttccacctcccagttatggaggt
attgaactagtagtaagtcacttgacaaacgaactagttcgtcgtggtcatgaggtaaca
ttatttgcctctggcgattctcaaaccttggcacatttagaaacagtttgtccgcgtgca
ttgcgcttagacaaaaatgttcaagactatgccgcttatgaaactttagaactgagccaa
gtttaccagaacgcgacggaattcgatattatccattctcatttagggatttcggcttta
cctttagcgaacttggtaaaaacccctacagtacatacgctgcatggacattttaccaaa
gataaccaaaacgtctttagtcatcatcatcaacaaccatacgttagtattagcaacgcc
cagcgtcaaattcatctcaactatataaaaaccgtttataacggtattgagccaaaagat
tatccgttcatttctcaaccaaaagagccgccatatctagcatttttaggacgcttttct
ccagaaaaaggcccacatcaggcgatcgcgatcgctaagcagagtggttggcgtttaaag
atggcaggaaaagttgatatagtagatgccaagttttttgaacaagagattcttcctcat
atagatggtcagcaaattgaatatttaggcgaaattaaccatacagaaaaagctgaacta
ctaggcaatgctgctgctactctttttccgatcaattggcaagaaccttttggtttagtg
atgattgaatcaatggcaactggtacgccagtcatagggatgaatttaggttctgtacct
gaggtgatcgaccaaggcaaaacaggttttatctgccgaacttatgaagaaatgattcag
atgatagctgttaccttggaattagatcgtcgagattgtagagaatccgtagtcaacaaa
tttagcgttagccacatggttgatgggtatgaagcggtatatcaacaaattatcaaagac
cgcgttaacttaaacggttatatccacacagctaaaatccgattttaa

DBGET integrated database retrieval system