KEGG   Trichormus variabilis: Ava_2561aHelp
Entry
Ava_2561a         CDS       T00277                                 

Definition
(GenBank) hypothetical protein
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnI Zn_Tnp_IS1595 Prim_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: ABA22176
CyanoBase: Ava_2561a
CYORF: Ava_2561a
UniProt: Q3MA10
Position
3162930..3163121
Genome map
AA seq 63 aa AA seqDB search
MSLRANNCPCCGGSLLRHVRHGELYWFCLSCRQEVPLLTNNSRLPNVDTRNNGGVVQTTV
SVE
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcgagccaataattgcccatgttgcggtggttctctcctccgccatgtccgt
cacggggaactatattggttctgcctatcttgccgccaagaagtcccactactaactaac
aatagtcgtttaccgaatgtggatactcgcaataatggaggagttgtccaaacaactgtg
agcgtcgaatag

DBGET integrated database retrieval system