KEGG   Trichormus variabilis: Ava_2566Help
Entry
Ava_2566          CDS       T00277                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran
Motif
Other DBs
NCBI-ProteinID: ABA22181
CyanoBase: Ava_2566
CYORF: Ava_2566
UniProt: Q3MA05
Position
3172284..3172499
Genome map
AA seq 71 aa AA seqDB search
MRLPEIQTIENTLDDINRQIPDKAESITSVGRDNKINDPDLSYKRLLYGLALVILAAFLF
VAAIYYGVINP
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgcgattaccagaaattcaaacgatagaaaatacactcgatgatattaatcgtcaaatt
cccgacaaagctgaatctatcacttcggtaggaagagataataaaatcaatgatccagat
ttatcatataagcgattgctttacggcttggctttggtaatattagcggctttcctattt
gttgctgccatttactacggagttatcaacccttaa

DBGET integrated database retrieval system