KEGG   Trichormus variabilis: Ava_2567Help
Entry
Ava_2567          CDS       T00277                                 

Definition
(GenBank) Photosystem I psaB
  KO
K02690  photosystem I P700 chlorophyll a apoprotein A2
Organism
ava  Trichormus variabilis
Pathway
ava00195  Photosynthesis
ava01100  Metabolic pathways
Module
ava_M00163  Photosystem I
ava_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Energy metabolism
   00195 Photosynthesis
    Ava_2567
Photosynthesis proteins [BR:ava00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Main subunits
    Ava_2567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PsaA_PsaB
Motif
Other DBs
NCBI-ProteinID: ABA22182
CyanoBase: Ava_2567
CYORF: Ava_2567
UniProt: Q3MA04
Position
3173015..3175243
Genome map
AA seq 742 aa AA seqDB search
MATKYPKFSRDLAQDPTTRRIWYAIATGNDFESHDGITEENLYQKIFATHFGHVAIIFLW
ASSLLFHVAWQGNFEQWIKDPLHIRPIAHAIWDPHFGEPAIEAFSQGGANYPVNIAYSGV
YHWWYTIGMRTNNDLYQGSIFLLLLAALFLFAGWLHLQPKFRPSLTWFKSAEPRLNHHLA
GLFGVSSLAWAGHLIHVAIPESRGVHVGWRNFLTTLPHPAGLTPFWMGNWGVYAENADTT
GHIFGTSQGAGTAILTFLGGFHPQTESLWLTDMAHHHLAIAVIFIIAGHMYRTNFGIGHS
IKEMLNARQFFGIRTEGQFNLPHQGLYDTYNNSLHFQLSIHLAALGTALSLVAQHMYSLP
PYAFIAKDFTTQAALYTHHQYIAGFLMVGAFAHAGIFWVRDYDPEQNQGNVLDRVLKHKE
AIISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQFIQAAHGKLLYGMDT
LLSNPDSIAYTAWPNHANVWLPNWLEAINSGTNSLFLTIGPGDFLVHHAIALGLHTTTLI
CVKGALDARGTKLMPDKKDFGFTFPCDGPGRGGTCQTSSWEQSFYLALFWMLNLLGWVTF
YWHWKHLGVWQGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGTNNLSVWAWMFLF
GHLVWATGFMFLISWRGYWQELIETLVWAHERTPLANLVRWKDKPVALSIVQGWLVGLAH
FTVGYILTYAAFLIASTAGKFG
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaaatatcctaaatttagccgggatctggctcaagatccgactacgcgtcga
atttggtatgcgatcgccacgggaaatgattttgaaagtcatgatggcataactgaggaa
aatctctaccaaaagattttcgctactcacttcggtcatgtcgccatcattttcttgtgg
gcatcaagtcttctgttccacgtcgcctggcaaggtaactttgaacagtggataaaagat
ccactccatattcgccccattgcccatgccatttgggacccccattttggtgaaccagcc
atagaggcttttagccaaggtggtgctaactatcccgtaaatattgcttactctggtgtt
tatcactggtggtataccatcgggatgcggacgaataacgacctttaccaaggttctatt
ttcctgttgcttttagcagccttatttttattcgcaggttggctacacttgcaacccaaa
tttcgtcctagcttgacttggtttaagagtgctgaacctcgtctgaatcaccacttagct
ggtttgtttggtgttagttccttggcttgggccggtcacttgattcacgtcgccatcccc
gaatctcgtggggttcatgtgggttggagaaactttctgactactttgcctcacccagca
ggtttaacaccattctggatgggtaactggggtgtgtatgccgaaaatgcagatacgacc
gggcatattttcggcacatcccaaggtgcaggaaccgctattttgacttttttgggtggt
ttccatccccaaactgaatcgctgtggttgactgatatggcgcatcaccatctagcgatc
gctgttatctttatcattgccgggcatatgtaccggactaactttggcattggtcacagc
atcaaagagatgctgaacgccagacaattctttggtatccgtactgaaggacagttcaac
ttaccccatcaagggttatacgacacttataacaactccttgcacttccaattatccata
cacttggcagcgttagggactgcgttgtcgttagtggcgcaacatatgtactcgctgccg
ccttacgcctttatagcaaaggactttacaacacaggcggcgctatatacccatcaccag
tacattgctgggttcttgatggttggcgcgtttgcccatgctggtattttctgggtacga
gactacgacccagaacaaaatcaaggtaacgtccttgaccgtgtactgaagcataaagaa
gcgattatctctcacctaagttgggtgtcgcttttcttaggcttccatactctaggacta
tacgttcacaacgatgttgtagttgcctttggcactccagaaaagcaaattttgattgag
ccggtgtttgctcaattcatccaagctgctcatggcaaactgctttatgggatggatact
ttattatctaacccagatagtattgcttatacagcttggccaaaccacgctaacgtctgg
ttgccaaactggctagaggcgattaactccggcactaactctttattcttgaccattggc
cctggtgatttcttggtacaccatgcgatcgctctcggtttgcataccaccaccttgatt
tgtgttaagggtgcgttggatgcccgtggtactaagctgatgcccgataagaaagacttc
ggcttcaccttcccctgtgatgggcctggccgtggtggtacttgccaaacctcctcttgg
gaacagtctttctatctggctctcttctggatgttgaatctcctgggctgggtaactttc
tactggcattggaagcatcttggggtttggcaaggtaacgttgctcagttcaacgaaaac
tccacatacctgatgggttggttccgtgattacctctgggctaattcggctcagttaatt
aacggttacaatccctacggcacaaataatttgtctgtctgggcttggatgttcctgttt
ggacatttagtttgggctaccggtttcatgttcctgattagctggcgtgggtactggcaa
gagttaattgaaactctagtttgggcgcacgagcgcacgcccctagctaacttagttcgt
tggaaagataagccagtggctctatctattgtgcaaggttggttagtcggtttagctcac
tttaccgttggttacatccttacctatgcagcattccttatagcctcaacggctggtaaa
tttggttaa

DBGET integrated database retrieval system