KEGG   Trichormus variabilis: Ava_2569Help
Entry
Ava_2569          CDS       T00277                                 

Definition
(GenBank) Virulence-associated E
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirE RepB_primase AAA_16 ABC_tran NACHT Septin CDC73_C
Motif
Other DBs
NCBI-ProteinID: ABA22184
CyanoBase: Ava_2569
CYORF: Ava_2569
UniProt: Q3MA02
Position
complement(3176621..3178714)
Genome map
AA seq 697 aa AA seqDB search
MKSINPILHQNSDYAQAETFLSLLCGDSETAVTWQTFDDSDSEQKDRTLAQCWHDTLASS
WNKLQRLNNKGAGVFVTVQETDGTGERKTANVVQVRALFIDCDNGIPDSWHLQPSLIVST
SADKCHAYWLLDESVQASADEFRGWQERLIAHYGSDKAVKDLARVMRLPGLLHKKGEPKL
VTIFEASGTRYAVDEIMDGLPEVGKPAKVNQPKPNYSDANFREKLEHFANKLKQAKEGER
NSTLNSTKYTLAGLFPDKLEDIDNCLFTVATECLGLSEEETRATLASANTGASKPITLTS
NGGKRSKSNLMRDTLEQLFGNSLQWDEMQNKLRFRGIHMSIEKLHDICERELDLDLPFDN
FRRIASVIAQDNPYHAVRSYLQSLTAAEDPEPILSALYQAMGITNRLHRLYVRRWLVSAV
ARALNPGCKADCALVLQGKQGIGKTTFFSSLFGESFQTLGEHKSDVDQLLAMTRSWCIEW
GEIENAFSKKAVSAIKSFMSIERDTYRRPYASEPDTYPRHFVICGTTNQSEFLTDSTGNR
RFWVVNLDQRVDTKAVEDMRDDVWSAVLALFLAGERWHLEGEEVEKAAEDTAQYEQDNPW
TEKITAYTARHNPCTVADIMENALGFDVSKLNDKKAQGDVTAILRQLGYTKEQKRLNGVK
ARYWYRPTLENTSTDDVRVTRDNIPAEENIEYSEDLY
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctattaacccaattctacaccaaaactctgactacgcgcaagctgaaaccttc
ttaagcttgctatgtggagactcagaaacagccgtcacttggcaaacctttgacgacagc
gacagcgaacagaaagatagaacactagcccagtgctggcacgatacgttagcaagctcg
tggaacaaactgcaacgactgaacaacaaaggtgctggcgtatttgtcacagtgcaagag
acagacggcacaggagagcgcaagacagcaaacgtagtccaagtacgcgcgttgttcatc
gactgtgataacggtatacccgatagctggcatttgcagcccagtctgattgtctctacc
agtgctgacaagtgtcatgcttactggttgctagatgagtctgtgcaagcgtcagccgat
gagttcagaggttggcaagaaaggctgattgctcactatggctcagacaaagctgtgaag
gacttggcgcgagtcatgaggctaccagggctactgcacaagaaaggcgaacccaagctg
gtaactatcttcgaggcttcgggtacacggtatgcagtagatgagattatggatgggtta
ccagaagttggcaagccagccaaggtaaaccagcctaagcctaactactctgatgcgaac
ttcagagagaaactagaacattttgccaacaaactaaagcaagccaaggaaggcgaacgt
aacagcactctgaactctaccaagtacaccttagctggcttgttccctgacaaactcgaa
gacattgacaactgtctattcactgttgcaaccgagtgtctaggtttgtctgaagaggaa
accagagcaacgttagccagtgcaaacacaggagccagtaagccgattacactaactagc
aacggaggcaaacgaagcaagagtaaccttatgcgggataccttagagcagttatttggc
aacagcttacagtgggatgagatgcagaataagcttaggttcagaggcattcacatgagc
atagagaagctacatgatatctgtgaaagagagttagacctagacctaccgttcgataac
ttccgtaggattgcctctgtgattgcacaagacaacccgtatcatgctgtccgttcttac
ctccagagcctcacagccgcagaagacccagagcctattctgtctgccctctaccaagca
atgggaatcaccaaccgtttacataggctgtatgttcgtcgttggcttgtgtctgctgtt
gctcgtgcgcttaacccaggatgcaaggctgattgcgcgcttgtgctacagggtaagcaa
ggcataggtaagacaacattctttagcagtctattcggtgagtccttccagacgctaggg
gaacacaagagcgacgtagaccaactgttagccatgactcgtagctggtgtatcgagtgg
ggcgagatagagaacgcattcagtaagaaagccgtgtcagccattaagtcattcatgagc
atagagcgtgacacctaccgtagaccttacgccagtgagcctgacacctacccaagacat
tttgttatttgcggaacaacgaaccagagcgaatttctaacagacagcacaggtaatcgt
aggttttgggttgtcaacttagaccaacgagtagacaccaaagccgtagaagacatgaga
gatgatgtctggtcagccgtgttagctctgttcttggctggtgaacgctggcacttggaa
ggcgaggaagtcgagaaagcagcagaagatacagcccaatacgaacaagataacccttgg
acagagaaaataacagcctacacagcgcgtcacaacccttgtactgttgctgacatcatg
gaaaacgctttaggcttcgacgtgagcaaactgaacgataagaaagcacagggagatgtt
acagctatccttcgtcaacttggttacacaaaagaacagaagcggcttaacggtgtaaaa
gctaggtactggtatcgcccaaccctagaaaacactagcactgacgacgtaagggtaact
agagacaacatccctgccgaagaaaacatagaatactcagaagacctttactaa

DBGET integrated database retrieval system