KEGG   Trichormus variabilis: Ava_2576Help
Entry
Ava_2576          CDS       T00277                                 

Definition
(GenBank) transposase, IS4 family
Organism
ava  Trichormus variabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_1
Motif
Other DBs
NCBI-ProteinID: ABA22191
CyanoBase: Ava_2576
CYORF: Ava_2576
UniProt: Q3M9Z5
Position
3183812..3185131
Genome map
AA seq 439 aa AA seqDB search
MVEDEVIASHLSALLTPAITSQENYYRQLGLRDRILNLPLMVAAVLTLLWRDVAGVTELT
RMLAREGFLWCRPLEVSQQAISQRFLTFPAQLFEKVFKDLLPHLQASWQRRNQRKIPPSV
QFTLTKFEKIWIVDCSILEALFQKLDSLKDAPQGQLAGKIGTVINLVNLLPVEIWFCENP
RTADTKFEADILNLVTPHTLLLLDRGFYHFNFWLQLIAQNVNFITRLKKGAAIHVQQVFT
DSFALRDRLVRLGSGTKKTTFITLRLVEIRSDKTWHSYLTSVLDPEVLPPYVVADLYRRR
WRIEDAFNTVKRLLGLSYLWTGSVNGVQLQVWGTWLFYAVLVDLGDAVADELSLPFDSIS
LEMIYRGLYHFYVAHQQGKATDPIKYFASPENQDLGIVKRQRKPNMKLIVAPFPDQQRGT
EEFFFQPPSKIPLTTGSQH
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggtggaagacgaagtaatagcatcgcatctgtcggcattactaacaccagccattaca
tcccaagaaaattactatcggcaactgggattaagagataggattctcaacttaccatta
atggtggcggcggtgctaactctactctggcgtgatgttgcaggagtcacggaactgaca
agaatgttagccagagaaggctttctatggtgtagacccctggaggttagccagcaagca
atatctcaaaggtttttaacttttccggctcaattatttgagaaagtatttaaagattta
ttgccacatttacaagcttcttggcaaagaagaaatcaacgtaaaatccccccaagtgtt
caatttactttgacgaaatttgaaaagatatggatagtagactgttcaatcttagaagcg
ttatttcagaagcttgatagcttaaaagatgcgccccaaggacaattagccggaaaaatt
ggcacggtcataaatttagtaaatcttctacctgtagaaatctggttttgtgagaatccc
agaactgctgatacaaagtttgaagcagatattttaaatttagttacaccccatacgttg
ctgttactagatagaggattctatcactttaacttttggctacaattaattgctcagaat
gtaaattttattactcggttgaagaagggagcagcaattcatgtccagcaagtatttaca
gatagctttgcgctaagagaccgtttggtgcgtcttggttctggcacaaagaaaactacg
tttattactttacgtctcgttgaaattcgttcagataaaacatggcattcttatttaact
agtgtacttgacccagaagttttacctccatacgttgtagctgatttataccgccgcaga
tggcgaattgaagatgcttttaatactgtaaagcgacttttgggtttaagttatttatgg
actggttctgttaatggtgttcaattgcaagtttggggtacttggttattttatgctgta
ttggttgatttaggtgatgctgtcgctgacgaactttctctaccttttgactccatttct
ttagagatgatttatcgtggactttatcatttttatgtagcccatcaacaaggcaaggca
actgaccctattaaatattttgcatctcctgaaaatcaagacttagggattgttaaacgg
caacgaaaaccaaatatgaagctcattgttgcacccttccctgatcaacaacgaggaact
gaggaatttttctttcaacctccttctaaaatccccttgacaactggctcacaacattaa

DBGET integrated database retrieval system