KEGG   Trichormus variabilis: Ava_2578Help
Entry
Ava_2578          CDS       T00277                                 

Definition
(GenBank) Metallophosphoesterase
  KO
K03651  3',5'-cyclic-AMP phosphodiesterase [EC:3.1.4.53]
Organism
ava  Trichormus variabilis
Pathway
ava00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:ava00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Ava_2578
Enzymes [BR:ava01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     Ava_2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2 Fucosidase_C
Motif
Other DBs
NCBI-ProteinID: ABA22193
CyanoBase: Ava_2578
CYORF: Ava_2578
UniProt: Q3M9Z3
Position
3186328..3187128
Genome map
AA seq 266 aa AA seqDB search
MNEKLPISIAQITDIHLLASESQRLQGISTIESFLAVMKRLEELRPELDLLLMTGDLSED
GTPESYENLQHYLNSLQIAAYWLPGNHDCAIAMDKILNLGMVSRRKSFQRGNWNFILLNS
SIPDCVYGYLSATTLDWLDSELRMLPNNPTLIALHHPPVSVNSAWIDGSCLRNSQELFAV
IDRYPQVKLVLFGHIHQEFRHQRHNVHYLGSPSTCYQFQSQSPIFAINQELPGFRLLKLY
ADGTWTTKIERVPYSLPIESAVTVSY
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaagttacccatctcaattgctcaaataacggacatacatctgttggcttca
gaaagccaaaggctacaaggaatatctacaatagagtcttttttagctgtgatgaagcgg
ctagaggaactacgaccagagttagacttgctgctgatgacgggagatttatccgaagat
gggacaccagaatcttatgaaaacctacaacactatttaaattcattgcaaatagccgct
tattggctcccaggaaatcatgactgtgcgatcgcaatggataaaatattaaatctaggc
atggtttcccgacgtaagtcttttcaacgtggaaattggaatttcattttgcttaactct
agtattcctgattgtgtatatggttatctctcagctactacactagattggctggattct
gagttaagaatgctacctaataaccccacattaatagcgttgcatcatcctcctgtatca
gtcaattccgcatggatagatggtagctgtctccggaattctcaagagttatttgctgtg
attgatcgttacccgcaggtcaagctagtcttgtttggtcatattcaccaagaatttcga
catcagcgccacaatgttcattacttgggatctccctcaacttgctatcagttccagtcg
caaagccccatttttgcgattaaccaagaactaccaggttttcgtttgttgaaactatac
gccgatggcacatggacaactaaaattgagcgagtgccttattccctcccaatagagtcg
gcggtaacggtatcttactaa

DBGET integrated database retrieval system