KEGG   Trichormus variabilis: Ava_2588Help
Entry
Ava_2588          CDS       T00277                                 

Definition
(GenBank) ParB family protein
  KO
K03497  chromosome partitioning protein, ParB family
Organism
ava  Trichormus variabilis
Brite
KEGG Orthology (KO) [BR:ava00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ava03000]
    Ava_2588
   03036 Chromosome and associated proteins [BR:ava03036]
    Ava_2588
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ava04812]
    Ava_2588
Transcription factors [BR:ava03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Ava_2588
Chromosome and associated proteins [BR:ava03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Ava_2588
Cytoskeleton proteins [BR:ava04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   Ava_2588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ParBc N6_N4_Mtase YARHG Tli4_N
Motif
Other DBs
NCBI-ProteinID: ABA22203
CyanoBase: Ava_2588
CYORF: Ava_2588
UniProt: Q3M9Y3
Position
3198373..3199716
Genome map
AA seq 447 aa AA seqDB search
MPTVPIDQIKIGRNRRPVKGEKVDELKESIKTNGLLNPITVDQRLTLIAGLHRLTACKLL
GLEAIECNIVNYDDADQARLAEIDENLIRNELEPLERSELWLERDQILARMGLRAKVGDN
QHTFKGGEMVSPPKRTIELAKEAGYSERTFQHGKQIAKSIHPEVKQLIKGTPIADSPTAL
LQVARAGTQERNLAESAQQAWELAKTQGDQEEAERQAKLIEELKVKQKAAQLLAYKSAIA
QKEAKLAAKKTQHQAEPVTADEPTTQIGDEWILGRHLVYCGDTAQAEFRNLLPSDAALAI
ATLSPTWEHNYLVDEAKVVAVIRSEGHIYEFYKRSQMPFQYELLLGNLYVGIFSHQVIAK
PQTPINIEGVEGIVNYLINLYTSPNHFVIAPFMGHGEILVTCERMGRICFIGDSNAELVG
RGIGRWQKWTSKKAIKSVTSETKIKKA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcctacagtacccatagaccaaattaaaatcggtcgcaaccgccgtccggtcaagggt
gagaaagttgacgaattgaaggagtccatcaaaacgaatggtctattaaaccctatcacg
gtagatcaacgccttaccttgattgctggactacatcggctgacagcttgtaagttgttg
gggttagaggccattgagtgcaatattgttaattacgatgatgctgaccaagccaggtta
gccgaaatcgatgagaatttgattcgcaatgagttagaacctttagagcgttcagaattg
tggttggaacgtgaccaaattctagcacgtatgggactgcgggcgaaagttggagataat
caacatacttttaaaggtggtgaaatggtttcaccacctaaaagaacaatagagttagcg
aaagaggctggttactcggaacgcacctttcagcatggtaagcaaattgccaaaagtatt
catccagaagtcaagcagttaattaagggtacacccattgcggatagtcccacagccttg
ttacaggtggcaagggcggggacgcaggagcgaaatttggcagagtcagcacagcaggct
tgggagttagccaaaactcagggtgatcaagaagaggcggaacgacaagcaaagctgata
gaagagttaaaggtaaagcaaaaagccgcgcagttattggcttataaaagtgcgatcgcc
caaaaggaagcgaagttagcagcgaagaaaactcaacaccaagcagaaccagtcaccgcc
gatgaacccacgactcaaattggtgatgaatggattttaggcagacatttagtctattgc
ggcgacacagcccaggcggaattccgcaatttgttaccttcagatgcagcattggcgatc
gctactctctcacccacctgggagcataattacttggtagatgaagccaaagttgtggcg
gttatccgttcggaagggcatatttacgaattttacaagcgtagtcaaatgccctttcaa
tatgaattattactaggaaatctttacgtaggaattttttctcatcaggtaatagctaaa
ccccaaacaccaattaatattgagggcgttgaaggaattgttaactatttgatcaatttg
tacaccagtcccaatcattttgtgattgctccatttatgggacatggtgaaattttagtt
acttgtgaaaggatgggcagaatttgttttattggcgacagcaatgcagaattagttggt
cgaggtattggcagatggcaaaaatggactagtaaaaaagccataaaatcagttactagt
gaaaccaaaattaaaaaagcataa

DBGET integrated database retrieval system