KEGG   Trichormus variabilis: Ava_3044Help
Entry
Ava_3044          CDS       T00277                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ava  Trichormus variabilis
Pathway
ava00010  Glycolysis / Gluconeogenesis
ava00030  Pentose phosphate pathway
ava00051  Fructose and mannose metabolism
ava00052  Galactose metabolism
ava00680  Methane metabolism
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
ava01120  Microbial metabolism in diverse environments
ava01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ava_3044
   00030 Pentose phosphate pathway
    Ava_3044
   00051 Fructose and mannose metabolism
    Ava_3044
   00052 Galactose metabolism
    Ava_3044
  Energy metabolism
   00680 Methane metabolism
    Ava_3044
Enzymes [BR:ava01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ava_3044
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Ava_3044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABA22654
CyanoBase: Ava_3044
CYORF: Ava_3044
UniProt: Q3M8N2
Position
complement(3770800..3771873)
Genome map
AA seq 357 aa AA seqDB search
MRKKIGILTSGGDCPGLNCVIRAVVSHATLTYDWEVFGIPYATQGLLERQAIALNMHGWD
LRGIDPLLNMGGTILGTINKGDTLAHVDEMLASYEALALDALIVIGGDGSLGILHELASR
GNWNLVAIPKTIDSDVALTERAVGFDTAVNTIVDALNRLTFTAASHDRVMIVEVMGRSAG
HLALHAGIAGGADVILIPEISYTISGLCQYIAELRDRWQRKFAIVVVAEGAKLCLEDVQE
NIASACVSPKCGRGQYIAEQIARCSKNLIDTRVSVLGHIQRGGIPSALDRLTATVFGKTA
VDLVAQGKFGQMVAWQNGEAIPVPIQDVVAQSPLHVNPQGSLVQSARCLGIYVGEKT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaaaattggtatcctcacaagtggtggtgactgtccagggcttaactgcgtg
attcgtgcagttgtcagccatgcaacacttacttatgattgggaagtatttggtatacct
tatgccactcagggtttactagagcgtcaagcgatcgctctgaatatgcacggctgggat
ttgcggggtattgaccctctgctaaatatgggtggcacgattttaggcactattaataag
ggtgacaccttagcgcacgtagatgagatgcttgccagttatgaggctttggctttggat
gctttgatcgtcattggtggtgatggtagtctgggcattctccatgaactagctagccga
ggtaattggaatttagtggcgattcccaaaactatagatagtgatgtggcgttgacagaa
cgcgctgtgggttttgatacggctgtcaatacaattgtcgatgccctcaatcgtttgacc
tttacggctgcaagtcacgatcgcgtgatgattgtcgaagttatgggacgcagtgccgga
catctagccctacacgcgggtattgccgggggtgcagatgtgattttaatccccgaaatt
tcatacacaattagtggtttatgtcaatacatagctgagttgcgcgatcgctggcaacgc
aaatttgcgatcgtcgttgttgctgaaggtgcgaaactatgtctggaagacgtgcaagaa
aatattgcctctgcttgtgtgtctcctaaatgcggtcgtggtcaatatattgcggagcaa
attgctcgatgcagtaaaaatctcatcgataccagagtttctgtattgggacacattcag
cgtggcggtatcccatcagctttagaccgtttaacagccacagtctttgggaaaacagcc
gttgatttagtagctcaaggtaaatttgggcagatggtagcctggcaaaatggcgaagct
atcccagtacccattcaagacgttgtagctcaaagtcctttacacgtaaatccccaaggt
tcgttggtacagagcgctcgttgtttgggtatttatgtaggagaaaaaacttaa

DBGET integrated database retrieval system