KEGG   Trichormus variabilis: Ava_3466Help
Entry
Ava_3466          CDS       T00277                                 

Definition
(GenBank) Light-independent protochlorophyllide reductase, B subunit
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
ava  Trichormus variabilis
Pathway
ava00860  Porphyrin and chlorophyll metabolism
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ava00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ava_3466
Enzymes [BR:ava01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Ava_3466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red
Motif
Other DBs
NCBI-ProteinID: ABA23073
CyanoBase: Ava_3466
CYORF: Ava_3466
UniProt: Q3M7G3
Position
4295958..4297484
Genome map
AA seq 508 aa AA seqDB search
MKLAYWMYAGPAHIGTLRVATSFKNVHAIMHAPLGDDYFNVMRSMLSRERDFTPVTTSVV
DRHVLARGSQEKVVENITRKDAEEHPDLIVLTPTCTSSILQEDLENFVERAQLDAKGDVL
LADVNHYRVNELQAGDRTLHQIVQYYIEKARKKGELPEGKTAKPSVNIIGISTLGFHNNH
DCTELKRLMADLGIEVNAVIPEGASVHELKNLPRAWFNLVPYRELGLMTASYLEKEFGTP
CIDIVPMGVVETARCIRKIQEVINAQGADVNYEEYINEQTLYVSQAAWFSRSIDCQNLTG
KKAVVFGDNTHAAALTKILSREMGIHVVWAGTYCKYDADWFREQVSEYCDEVLITEDHGE
IGDAIARVEPSAIFGTQMERHVGKRLDIPCGVIAAPIHVQNFPIGYKPFLGYEGTNQITD
LIYNSFTLGMEDHLLEIFGGHDTKEVITKGISAESDLSWTKDGLAELNKIPGFVRGKVKR
NTEKFARDRGFKDISAEVLYAAKEAVGA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaattggcttactggatgtatgcaggcccagcccacattggcactttgcgagtcgca
acttcatttaaaaacgtccatgctattatgcacgcgcctctaggcgatgactactttaac
gttatgcgctcaatgctgtcgcgggagcgggacttcacaccagtaacaaccagcgtggtt
gaccgccatgttttagcccgtggttctcaagaaaaggtggtagaaaacatcacccgcaaa
gatgcagaggaacacccagatttaattgtcttaactcccacctgtacctccagtattttg
caagaagacttggaaaactttgtcgaacgcgcccaattggatgcgaaaggggacgtatta
ctggcggatgtgaaccactatcgggtgaacgaactgcaagcaggcgatcgcactctccac
caaattgttcaatactatattgaaaaagcccgcaaaaaaggcgaactcccagaagggaaa
acagccaagccctcagttaacattatcggcatttctaccctggggttccacaataaccac
gactgcaccgaactcaaaaggctaatggctgatttgggaattgaggtcaacgcggtcatt
cctgaaggcgcttccgtccacgagttgaagaatttacccagagcttggtttaacctcgtt
ccttaccgggaattgggtttaatgacagctagttacctggaaaaagaatttggcacacct
tgtatagatattgtgccaatgggtgtagtagaaactgcccgatgtatccgtaaaattcag
gaagtgattaacgctcaaggtgctgatgttaattacgaagagtatatcaacgagcaaacc
ttgtatgtatcccaagctgcctggttctcccgttccatcgactgtcaaaacctgactggg
aaaaaagcagtggtttttggcgacaacacccacgccgccgccttgacaaagattttgtcc
cgcgaaatggggattcacgttgtttgggcgggaacctactgcaagtatgatgctgattgg
ttccgcgaacaagtaagcgagtattgcgatgaagtactgattacggaagatcatggggaa
attggggatgcgatcgcccgtgttgaaccctccgccatcttcggtacacaaatggaacgc
cacgttggtaagcgtttagatattccttgtggtgtgattgctgcacccattcacgtacaa
aacttccccatcggttacaaaccattcttgggttatgaaggaaccaatcaaatcacagat
ttaatctacaattcctttactttaggtatggaagaccacctattagaaatatttggtgga
catgataccaaggaagtaattactaaaggtatttctgctgaatctgacctgagttggaca
aaagacggcttggcagaactgaacaaaatccctggtttcgtgcggggaaaagtcaagcgg
aatacagaaaaatttgcacgcgatcgcggttttaaagatatctcagcagaggtgttatac
gcagccaaggaagcagtaggagcatag

DBGET integrated database retrieval system