KEGG   Trichormus variabilis: Ava_3798Help
Entry
Ava_3798          CDS       T00277                                 

Definition
(GenBank) Phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ava  Trichormus variabilis
Brite
KEGG Orthology (KO) [BR:ava00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Ava_3798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ABA23403
CyanoBase: Ava_3798
CYORF: Ava_3798
UniProt: Q3M6I3
Position
4733281..4734240
Genome map
AA seq 319 aa AA seqDB search
MLLISLFIATLFLAYANGANDNFKGVATLFGSRTTSYQTAILWATFTTFAGSLTATYLGR
TIVKEFTGKGILPDAIANAPEFHLAVAIASGLTVLLATTMGFPISTSHSLIGAMFGAGLV
AFGLQVNFAILGIYFIFPLLLSPIIAIAFSAGIYSLINYLSIRLNWQLNHKIIDTLHYIS
AGIFSFARGLNDTSKIVSIVLIIDYFSLSGAMITIAMAMGLGGLLNSQKIAETMSTKITS
MNRIQGVSANIITSILVILASNFGLPVSTTHVAVSSIFGVGLVGSKANKYIFYQILLVWL
VNLPIATIIGGITYRLLQG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttgttaattagtctgtttattgctaccctgttcctggcttatgctaatggagctaat
gacaactttaagggtgtagcgacgctgtttggtagtcggacaacaagctaccaaacagca
attttgtgggcaacttttacgacttttgcaggttctttaactgctacttatttaggtaga
acaatagttaaagagtttactggtaagggtattttaccagatgcgatcgccaatgcacca
gagtttcatttagcggtggcgatcgcctctggcttgacggtactactggctactacgatg
ggatttcccatttccacatcccacagtttaatcggtgcaatgtttggtgctggactggta
gcgtttggactccaggtaaattttgccattttaggaatctatttcattttccccctatta
ttaagtcctattattgctattgccttcagtgcaggaatttacagtttaattaattactta
agtattaggctgaattggcagttaaatcataaaataattgatacccttcattatatcagt
gctggtatattcagctttgctagaggacttaatgatactagcaaaattgtctctatagtc
ctaattatcgattatttctcactttctggggcaatgattaccatcgcaatggctatgggt
cttggtggtttactcaattctcaaaaaattgctgaaaccatgagtacaaaaattacctct
atgaatcgtatccagggagtatcggccaatatcattactagtattctagtgattcttgct
agtaattttgggttgcctgtatctacaactcatgtcgcagtatcttctatttttggtgta
ggattagttggtagtaaagccaataaatatattttttaccaaattttattagtctggttg
gtcaacttacctattgccaccattattggtggtatcacctatagactattacaaggttag

DBGET integrated database retrieval system