KEGG   Trichormus variabilis: Ava_4892Help
Entry
Ava_4892          CDS       T00277                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ava  Trichormus variabilis
Pathway
ava00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ava01100  Metabolic pathways
ava01110  Biosynthesis of secondary metabolites
ava01130  Biosynthesis of antibiotics
ava01230  Biosynthesis of amino acids
Module
ava_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ava00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ava_4892
Enzymes [BR:ava01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ava_4892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG FMN_dh NanE
Motif
Other DBs
NCBI-ProteinID: ABA24489
CyanoBase: Ava_4892
CYORF: Ava_4892
UniProt: Q3M3E7
Position
6161090..6161932
Genome map
AA seq 280 aa AA seqDB search
MLYPSAINTNRLQPIIREIVWQKKQEVAQLHQQMSLASLQRQLTAAPTVRDFLTALQQNP
YQPSLIAEIQKASPNHGMIRADFDPVAIAKAYERGGAACLSVVTDTSFFHGSFEILRAIR
QRVPLPILCKEFIIDPCQIYLARAAGADAVLLIAAILTDRELKDFLRIIHFLGMNALIAV
HSLAELDRILKLDDIRLIEINNQSLQDFTTDISTTQNLLAARRSHLQNLGITVVSESGLY
THTDLSLVTEAGANAVIVGESLIKEQDIELAVRHLLTGNK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatcccagcgccattaataccaaccgtctgcaaccaattatcagagaaattgtt
tggcaaaaaaagcaagaagttgcacaactacaccaacagatgtcattggcttccttacaa
cgccaattaactgctgcgccaaccgtgcgggatttcttgacagccttgcagcaaaatcct
taccaacctagcctgattgcagaaatacaaaaagcatcacccaatcatggtatgattcgt
gctgattttgatccagtagcgatcgccaaagcttatgaacgaggtggcgcagcttgtcta
tcagtagtgacagatacctcattttttcatggtagttttgaaattctccgtgctatacgc
caacgggtaccattacccatattatgcaaagagtttattatcgacccctgccaaatttat
ttagcacgagcagcaggagccgatgcagtactattaattgcagctattctcacagacaga
gaactgaaagattttttgcgaataattcactttctggggatgaatgccttaatcgcagtt
catagtttagctgaactagataggatactcaaactagacgacattcgcttaatcgaaatt
aacaaccaaagtctgcaagattttaccacagatatcagcaccacccaaaatttattagca
gctaggcgatcgcatctacaaaacttgggtatcaccgtcgtcagcgaatctggattatat
acacacacagacttatccttagtcacggaagctggcgcaaatgccgtgatagtcggagaa
tctttaattaaagaacaagatatcgagttagctgtacgtcacctgcttacagggaataaa
taa

DBGET integrated database retrieval system