KEGG   Trichormus variabilis: Ava_C0102
Entry
Ava_C0102         CDS       T00277                                 
Name
(GenBank) Glucose-methanol-choline oxidoreductase
Organism
ava  Trichormus variabilis
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C FAD_binding_2 DAO Lycopene_cycl Pyr_redox_3 Thi4 NAD_binding_8 Pyr_redox_2 HI0933_like
Other DBs
NCBI-ProteinID: ABA25191
CyanoBase: Ava_C0102
UniProt: Q3M1F2
Position
C:complement(124255..125811)
AA seq 518 aa
MTTTYHHSAAFDYIVIGAGSAGCVVANRLTEDPNTKVLLLEAGDPDTKPELQVPSLWPTT
LLGSEVDWAYLTEGEPYLNNRKILSSRGKVLGGSSSINGMIYIRGNERDYNSWQALGNIG
WSYQDVLPYFKKSENQQRGASLFHGVDGPLSITDPLSPAKVSQRFVEAAIAQGYEQNPDF
NGVQQEGAGLYQVTVKDGKRQSTAVAFLRPIKDRPNLTIQTGALVTRLLFEGKRAVGVVY
VQNGTEYQIRVNSEVILSAGAFDSPKLLMLSGIGPAEHLRAVGIPVVFDLPGVGQNLQDH
PLAVIAYQSTQDVPLAPSSNGGEAGLFLHTNNNLDAAPNLQFTIVPILYVDPAYAREGPG
FTLTFYITRPESRGSVRLRSSSPFDPPLIRVNYLQKESDMQLMVEGLKILRQIVYSDAFN
EFRGEEIAPGSSVHSDKAIEDYIRQTCGTGWHPVGTCKMGIDQMAVVDPQLKVRGIEGLR
VVDASIMPTMITGNTNASAIMIGEKAADLIKVGTKLPQ
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgacaactacataccatcacagtgctgcttttgattatattgtgattggcgccggttca
gcaggctgcgttgttgccaaccgtcttacagaagaccctaatactaaagtattgctgctc
gaagcgggtgatcctgataccaagccagaacttcaagttccctcattgtggcctactaca
ctcttaggctcggaagtggactgggcatacttaactgaaggggaaccttacttaaataac
cgcaaaattttatcttcacgcggtaaagtcttgggcggcagcagttcgattaatggcatg
atttatatacgaggcaatgaacgtgactacaatagctggcaagcgttaggtaatattggt
tggagttatcaggatgtcttgccttacttcaagaaatcggaaaaccagcagcggggagca
tcgttatttcacggggttgatggaccacttagtatcacagatccactttctcctgcaaaa
gtgtcgcaacgctttgtggaagccgcgatcgcacagggctatgagcaaaatcccgacttt
aatggcgtacagcaggaaggtgcaggactttaccaagtgaccgtgaaagatggcaagcgc
caaagtacagcagtggcatttctgcgtccgattaaagatcgccccaacttgaccattcaa
acaggagcattggtgactcgtttactctttgagggaaagcgtgcagtaggggtagtgtat
gttcaaaatggaacggagtatcaaatcagggtcaactccgaagtgattttgagtgctggc
gccttcgattctcctaaactgctcatgctttctggaattggacctgctgaacatctgcgg
gcagtaggcattcctgtagtttttgatttgccgggtgtcggccagaatcttcaagatcac
ccacttgctgttattgcctaccagtctactcaggacgtaccccttgcgccaagtagtaat
gggggagaggctgggttatttctgcataccaacaataatttagatgcggcacctaatttg
caatttacaattgttccgattttatatgtcgatcctgcctatgcacgtgaaggtccggga
ttcacccttaccttttacatcacccgtcccgaaagtcgtggtagtgtaagactacgttcc
tcctcccccttcgacccaccgttgattcgcgtcaactatcttcagaaagaatctgacatg
caactgatggttgaaggacttaaaattttgcgtcaaattgtgtactccgatgcgtttaat
gagtttcggggtgaggaaattgctccagggagttccgtgcatagcgacaaagcaatcgaa
gattatattcggcaaacgtgcggtacgggatggcatcctgttgggacgtgcaaaatgggt
attgatcaaatggcggttgtcgatcctcaactcaaggtacgggggattgaagggttacga
gttgttgatgcatcgattatgccaactatgatcacaggaaacacaaatgcatcggcaatt
atgattggagaaaaggctgccgatttgataaaagttggaacaaaattgcctcaatga

DBGET integrated database retrieval system