KEGG   Azotobacter vinelandii CA6: AvCA6_04080Help
Entry
AvCA6_04080       CDS       T02634                                 

Gene name
mqo
Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd00020  Citrate cycle (TCA cycle)
avd00620  Pyruvate metabolism
avd01100  Metabolic pathways
avd01110  Biosynthesis of secondary metabolites
avd01120  Microbial metabolism in diverse environments
avd01130  Biosynthesis of antibiotics
avd01200  Carbon metabolism
Module
avd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
avd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:avd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AvCA6_04080 (mqo)
   00620 Pyruvate metabolism
    AvCA6_04080 (mqo)
Enzymes [BR:avd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     AvCA6_04080 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AGK18315
UniProt: M9YBX1
Position
complement(388420..390039)
Genome map
AA seq 539 aa AA seqDB search
MKKLLLTFLCASIVGCAKQDDAEKTVDVLLIGGGIMSASLGTYLKELEPDWTIDIYERLD
QVAEESSNPWNNAGTGHSAFCELNYTSEKPDGHVDISKALAVTESFEISRQFWAHQIDKG
VLSNPKSFINDVPHISFVWGDENVAFLKKRHEAMQHSSLYRGMEYTEDHATINEWAPLVM
EGRTAGQKVAATRMPIGTDVNFGEITRQLMGALTRHGNVTLNLKHEVRDFVRNDDGTWNV
TVADLAKGGEEKTVKAKFVFIGAGGGALPLLQKTGIPEADGYAGFPVGGQFLYTTNPEVV
ERHLAKVYGKASVGAPPMSVPHLDTRVIDGKRAILFGPFATFSTKFLKKGSLLDMPRSLS
TDNFMPIMHAGLDNLPLSTYLIGQLMLSQEERIEELREYFPQAKAEDWKLLTAGQRVQVI
KKDPEKGGVLQFGTEVVAAADGSIAALLGASPGASTAAPIMLTVLEKTFKDRIGTPEWQA
KLKEIVPSYGQKLNNNIELTNNIRAMTSERLQLRFMPVEPEAAEAQAEATAPQPAQAAL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactgttactgaccttcttgtgcgccagcatcgtcggctgcgccaagcaggac
gacgcggagaagaccgtggacgtcctgctgatcggcggcggcatcatgagcgccagcctc
ggcacttacctcaaggagctggagcccgactggacgatcgacatctacgaacgcctcgac
caggtcgccgaggaaagctccaatccctggaacaacgccggcaccggccactcggcgttc
tgcgaactgaactacacctccgagaaacccgacggccatgtcgacatcagcaaggcgctg
gcggtcaccgaatccttcgagatctcccggcagttctgggcccaccagatcgataagggc
gtgctgagcaatccgaaatccttcatcaacgacgtgccgcacatcagcttcgtctggggc
gacgagaacgtcgccttcctgaagaaacgccacgaggcgatgcagcacagctccctgtac
cgcggcatggagtacacggaagaccacgcgaccatcaacgaatgggcgccgctggtgatg
gagggccgcacggccggccagaaggtcgccgcgacgcgcatgccgatcggcaccgacgtc
aacttcggcgaaatcacccgccaattgatgggtgcgctgaccaggcacggcaacgtcacg
ctgaacctcaagcacgaggtacgcgacttcgtacgcaacgacgacggcacctggaacgtg
acggtcgccgacctggccaagggcggcgaggagaagaccgtcaaggctaagttcgtgttc
atcggcgccggcggcggcgcgctgccgctgctgcagaagaccggcatccccgaggccgac
ggctatgccggcttcccggtgggcggccagttcctctacaccaccaaccccgaggtcgtc
gaacgccacctggccaaggtctacggcaaggcctccgtcggcgccccgccgatgtccgtg
ccgcatctggacacccgcgtgatcgacggcaagcgggcgatcctgttcggacccttcgcc
accttctccaccaagttcctgaagaagggctcgctgctggatatgccgcgctcgctgagc
acggacaacttcatgccgatcatgcacgccggcctcgacaacctgccgctcagcacctac
ctgatcggccagttgatgctcagccaggaagaacgcatcgaggaactgcgcgagtatttc
ccgcaggccaaggccgaggactggaaactgctgaccgccggccagcgcgtccaggtcatc
aagaaggacccggagaaaggcggcgtcctgcagttcggcaccgaagtcgtggccgccgcg
gacggcagcatcgccgcgctgctgggcgcctcgccgggcgcctccaccgccgcgccgatc
atgctcaccgtgctggaaaagaccttcaaggacaggatcgggactcccgagtggcaggcc
aagctgaaggaaatcgttccctcctacggccagaagctcaacaacaacatcgagctgacc
aataacatccgcgccatgaccagcgagcgcctgcaactgcgcttcatgccggtcgagccg
gaagccgccgaggcccaggccgaggccactgctccccaacccgcccaggcggccctgtaa

DBGET integrated database retrieval system