KEGG   Azotobacter vinelandii CA6: AvCA6_07370Help
Entry
AvCA6_07370       CDS       T02634                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd00071  Fatty acid degradation
avd00072  Synthesis and degradation of ketone bodies
avd00280  Valine, leucine and isoleucine degradation
avd00310  Lysine degradation
avd00362  Benzoate degradation
avd00380  Tryptophan metabolism
avd00620  Pyruvate metabolism
avd00630  Glyoxylate and dicarboxylate metabolism
avd00640  Propanoate metabolism
avd00650  Butanoate metabolism
avd00900  Terpenoid backbone biosynthesis
avd01100  Metabolic pathways
avd01110  Biosynthesis of secondary metabolites
avd01120  Microbial metabolism in diverse environments
avd01130  Biosynthesis of antibiotics
avd01200  Carbon metabolism
avd01212  Fatty acid metabolism
avd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:avd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AvCA6_07370
   00630 Glyoxylate and dicarboxylate metabolism
    AvCA6_07370
   00640 Propanoate metabolism
    AvCA6_07370
   00650 Butanoate metabolism
    AvCA6_07370
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AvCA6_07370
   00072 Synthesis and degradation of ketone bodies
    AvCA6_07370
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AvCA6_07370
   00310 Lysine degradation
    AvCA6_07370
   00380 Tryptophan metabolism
    AvCA6_07370
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AvCA6_07370
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AvCA6_07370
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AvCA6_07370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:avd04147]
    AvCA6_07370
Enzymes [BR:avd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AvCA6_07370
Exosome [BR:avd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AvCA6_07370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGK19487
UniProt: M9YMI2
Position
695283..696470
Genome map
AA seq 395 aa AA seqDB search
MSQDPVVIVSAARTPLGAFQGELSGLSAPRLGGVAVRAALQRAGLPGERVQELILGCVLP
AGLGQAPARQAAIEAGLPLSVGCTTVNKVCGSGMKAAMLAHDLLLAGSAEVVLAGGMESM
SNAPYLLPGARGGYRLGHRQALDHMFFDGLEDAYFDRGRLMGTFAEDCAASHGFGREEQD
TWAIASTSRARAAIESGAFAWEIAPVSLSGRHGEVLIEHDEQPPKARLERIPELKPAFRE
GGTVTPANSSSISDGAAALLLMRRSTAGRLGLAPLATVVGHASHAHEPRLFPTAPVGAMR
KLLERLGWSVGDVDLWEINEAFAVVTLAAIRDLRLDPARVNVHGGACALGHPIGASGARI
LVTLLGALRRGGGRRGVASLCIGGGEATAMAVEMA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggatccggttgtcatcgtttccgccgcgcgcacgccgctcggcgcgttccag
ggcgaactctccgggctgagcgcgccgcggctgggcggcgtcgccgtgcgcgcggcgctg
cagcgggccggccttcccggcgagcgggtgcaggaactgatcctcggctgcgtgctgccg
gccgggctcggccaggcgccggcccgccaggcggcgatcgaggcaggtttgccgctgtcg
gtcggctgcaccacggtcaacaaggtgtgcggctccgggatgaaggccgccatgctggcc
catgacctgctgctcgccggcagcgccgaggtcgtgctggccggcggcatggagtcgatg
agcaacgccccctacctgctgcccggcgcgcgcggcggctaccggctcgggcatcggcag
gcgctcgaccacatgttcttcgacggtctggaggatgcctacttcgaccggggccggctg
atgggcaccttcgccgaggattgcgcggccagccacggcttcggccgcgaggagcaggac
acctgggccatcgcctcgacgagccgcgcccgggcggccatcgagtccggtgccttcgcc
tgggaaatcgccccggtgagcctctccggccgccacggcgaggtactgatcgagcacgat
gaacagccgccgaaggcacgtctggagcggattcccgaactcaagccggcctttcgcgag
ggcggtacggtgacgccggccaactccagctcgatttccgacggcgccgccgcactgctg
ctgatgcgccgctccacggccggacggctcggactcgcgcccctggcgaccgttgtcggc
catgccagccatgcccatgagccgcggctgtttccgaccgcgccggtcggcgcgatgcga
aaactgctggagcggctcggctggtcggtcggcgacgtcgacctgtgggaaatcaacgag
gccttcgcggtggtgaccctggcggcgatccgcgatcttaggctcgatccggcacgggtc
aacgtccatggcggcgcctgcgccctgggacatccgatcggcgcgtccggggcgcgtatc
ctggttaccctgctgggcgccctgcgccgcggcggcggacggcgtggcgtcgccagcctg
tgcatcggcggtggcgaggcgacggcgatggcggtggagatggcctga

DBGET integrated database retrieval system