KEGG   Azotobacter vinelandii CA6: AvCA6_10180Help
Entry
AvCA6_10180       CDS       T02634                                 

Gene name
selD
Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd00450  Selenocompound metabolism
avd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AvCA6_10180 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:avd03016]
    AvCA6_10180 (selD)
Enzymes [BR:avd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     AvCA6_10180 (selD)
Transfer RNA biogenesis [BR:avd03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    AvCA6_10180 (selD)
 Prokaryotic Type
    AvCA6_10180 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AGK18795
UniProt: M9YD99
Position
965734..966771
Genome map
AA seq 345 aa AA seqDB search
MSEPIRLTQYSHGAGCGCKIAPKVLEVILAGSGAQNLDPKLWVGNASRDDAAVYAIDEER
GVVSTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGDPLLAIAILGWPINKLPPEVAREV
VAGGRAVCDAAGIPLAGGHSIDTPEPVFGLAVTGMVEKRFLKRNDTASAGCRLYLTKPLG
IGILTTAEKRSRLRPQDVGVARDWMCTLNKPGSRFGKLAGVRAMTDVTGFGLLGHLVEMA
DGSGLSACIEFAAVPRLPELDYYLEQGCVPGGTLRNFDSFGERIAPMPELCKLILCDPQT
SGGLLVAVSPEGEAEFLACAAELGLALAPIGEMVERQRLAVEVLF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcccattcgtctgacccagtacagccatggcgccggttgtggctgcaagatc
gcccccaaggtgctggaagtgatcctcgccggcagcggcgcacagaatctcgacccgaag
ctctgggtcggcaacgcctcgcgcgacgacgccgccgtgtacgccatcgacgaggagcgc
ggcgtggtgtcgaccaccgatttcttcatgccgatcgtcgacgaccccttcgacttcggg
cgcatcgccgcgaccaacgccatcagcgatatctacgcgatgggtggcgatccgctcctg
gccatcgccatcctcggctggccgatcaacaagctgccgccggaagtggcccgcgaggtg
gtcgccggcggtcgcgcggtctgcgatgcggcgggcatcccgctggccggcggacattcc
atcgacaccccggagccggtcttcggcctggcggtgaccggcatggtggaaaagcgtttt
ctcaaacgcaacgacaccgccagcgccggctgccggctatacctgaccaagccgctgggc
atcggcatcctcaccaccgcggagaagcgctccaggctacgtccccaggatgtgggcgtg
gcgcgcgactggatgtgcaccctgaacaagcccggcagccgcttcggcaagctggcgggg
gtcagggcgatgaccgacgtcaccggcttcggcctgctcggccacctggtcgagatggcc
gacggcagcgggctgtcggcgtgcatcgagttcgccgcggtgccgcgccttcccgagctg
gactactacctggagcagggctgcgtccccggtggcaccctgcgcaacttcgacagcttc
ggcgagcgcatcgcgccgatgccggagctgtgcaagctgatcctctgcgacccgcagacc
agcggcggcctgctggtcgcggtgagccccgagggcgaggcggagttcctcgcctgcgcc
gccgaactgggcctggcgctggcgccgatcggcgagatggtcgagcgacagcgcctggcg
gtcgaggtgctcttctga

DBGET integrated database retrieval system