KEGG   Azotobacter vinelandii CA6: AvCA6_15450Help
Entry
AvCA6_15450       CDS       T02634                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd00480  Glutathione metabolism
avd00590  Arachidonic acid metabolism
avd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AvCA6_15450
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AvCA6_15450
Enzymes [BR:avd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AvCA6_15450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AGK19964
UniProt: M9YHG9
Position
1516156..1516632
Genome map
AA seq 158 aa AA seqDB search
MRDPLFGIPLDDQPRTLADFPGRAWLVVNTASRCGFTPQYEGLQMLWQRYRERGLVVLGF
PCDQFGHQEPGNELEIAEFCQLRYGVDFPLFQKVEVNGPRAHPLFVELKKRAPGLLGSQR
VKWNFTKFLIGREGRVVRRFAPATGPRELCGEIEALLE
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacccgttgttcggcattcccctcgatgaccagccgcggacgctggccgatttt
cccgggcgcgcctggctggtcgtgaacacggccagccgttgcggtttcacgccccagtac
gaaggcctgcagatgctctggcagcgttatcgggaaaggggattggtggtgctcggcttc
ccctgcgatcagttcggtcatcaggagccaggcaatgaactcgaaatcgccgagttctgc
cagcttcgctatggcgtcgattttccgctgtttcagaaggtcgaggtcaatgggccccgg
gcacaccccctgttcgtggaattgaagaagcgcgcgccaggcctgctgggtagccagagg
gtgaagtggaacttcaccaagttcctgatcggccgggagggccgggtggtcaggcgtttc
gctcccgcgaccggcccacgcgagctgtgcggcgaaatcgaagccctgcttgaatag

DBGET integrated database retrieval system