KEGG   Azotobacter vinelandii CA6: AvCA6_26770
Entry
AvCA6_26770       CDS       T02634                                 

Definition
(GenBank) hypothetical protein
  KO
K07169  FHA domain-containing protein
Organism
avd  Azotobacter vinelandii CA6
Brite
KEGG Orthology (KO) [BR:avd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    AvCA6_26770
SSDB
Motif
Pfam: FHA Yop-YscD_cpl
Other DBs
NCBI-ProteinID: AGK20804
UniProt: M9YJU6
Position
2744499..2746196
AA seq 565 aa
MRLTVLEYGGEAPSPPLSMLFSAPGGTIGRGADNHLVLPDDTRQISRLQAVLQVGEAGAQ
LKNLSPVCPIEINEKPLAQQEEHPLCAGDIVRIGAYLLRAETAAPAQPALAPPPAEPMAA
FAEAETALSPPGADSPPGAPMSETPAPREPAGDTSAAPSPPERAALAEEAPASGMDAAPA
GRADGEAAPAGQPEAQPERDEVPASAAVPEAFWENLIAEFARHPAPESLSPADEIQAPLA
SGQAETTVATEDTLAALNRIPVDPLALFDATPGEDPDALFDDSPSALAGPPAIPLDIRPT
GPVVAPQANRVAELNGHFQAPRVGPRREGPPATGAGPSARPDDPPGGAPTGGDPAAHGKA
KTTKDAAGAFREGAGLEASYALGDEQLHCAGRLLASLLGGTMALLSSRTIIKREVKADLT
LILERENNPLKLLPDANTVLKQMFGPPFPGFMAPEQAVDDAFHDLQAHQIGMLAGMRAAL
RQLLHKVSPALVEQQLGAPDWRERLLPGGRDSRAWAHYRNLHQAMLTALEEDFHTVFGQA
FLAAYDAEVELYRQQCRRTACHRNA
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcgattgaccgtactcgaatacggtggagaggcgcccagcccgccactgagcatgttg
ttcagcgcccccggcggcaccatcgggcgaggcgccgacaaccatctggtactgcccgac
gacacacgacagatctccaggctgcaggccgtgctgcaggtgggcgaggccggcgcgcaa
ctgaaaaacctcagccccgtctgcccgatcgaaatcaacgaaaaaccgctggcgcagcag
gaggaacatcccctgtgcgccggcgacatcgtgcgtatcggcgcctacctgctgcgcgcg
gaaacggccgcccccgcacagccagcgctcgctccgccgccggccgagccgatggcggcg
ttcgccgaggccgagacggcgctgtccccgcccggcgcggattcgcccccgggcgcgccc
atgagcgaaacgccggcgccgcgggaaccggccggcgatacctcggcagccccgtcgccg
cccgagcgcgcggcgctcgccgaggaggcgccggccagcgggatggacgccgcgccggca
ggccgcgccgatggcgaggcggcgcctgccggccagcccgaggcccagcccgagcgcgac
gaggtgcccgccagcgcagccgtcccggaagccttctgggaaaacctgatcgcggagttc
gcccggcatcccgcgcccgaaagcctgagccccgccgacgaaatccaggcccccctggct
tccgggcaggccgaaacgacggttgcgaccgaagatacgctggccgccctgaacaggatt
cccgtcgatcccctggcgctgttcgatgccactcccggcgaggacccggacgcgcttttc
gacgacagtcccagcgccctggccgggccgcccgccatcccgctcgatatccgcccgaca
gggcccgtcgtcgcgccgcaggcgaatcgcgtggcggaactgaacggccacttccaggcg
ccccgcgtcgggccacgccgggaagggccgccggcgaccggcgccggcccgtcggcgcgg
ccggacgatccgccgggcggcgctccgacgggcggcgacccggccgcgcacggcaaggcg
aaaaccacgaaagacgccgccggcgccttccgcgagggcgccggtctcgaagccagctat
gccctgggcgacgaacaattgcactgcgccgggcgcctgctcgccagcctgctcggcggc
accatggccctgctctccagccgcaccatcatcaagcgcgaggtcaaggccgacctgacc
ctgatccttgagcgggaaaacaacccgctcaagctgctgcccgacgcaaacacggtgctg
aaacagatgttcggcccgccgtttccgggcttcatggcgccggagcaggccgtggacgac
gccttccacgacctgcaggcgcaccagatcggcatgctggccggcatgcgcgcggccctg
cggcagttattgcacaaggtcagccccgccctcgtcgagcagcaactgggcgcccccgac
tggcgcgagcggctgctgccgggcggccgcgacagccgggcctgggcgcactaccgcaac
ctgcaccaggccatgctgacggcgctggaggaagacttccatacggtgttcggccaggct
ttcctcgccgcctacgacgcggaggtcgaactctatcgccagcaatgccgccgaaccgcc
tgccacaggaatgcctga

DBGET integrated database retrieval system