KEGG   Azotobacter vinelandii CA6: AvCA6_33080Help
Entry
AvCA6_33080       CDS       T02634                                 

Gene name
cobQ
Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd00860  Porphyrin and chlorophyll metabolism
avd01100  Metabolic pathways
Module
avd_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:avd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AvCA6_33080 (cobQ)
Enzymes [BR:avd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     AvCA6_33080 (cobQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB BPL_N
Motif
Other DBs
NCBI-ProteinID: AGK17677
UniProt: M9YGX7
Position
complement(3381082..3382539)
Genome map
AA seq 485 aa AA seqDB search
MTTLMVQGTTSDAGKSTLVTALCRWLARQGVAVAPFKPQNMALNSAVTADGGEIGRAQAV
QAQACGLAPHTDMNPVLLKPDSDTGAQVIVHGRAVACMDAAAYHDYKRVAREAVLASHRR
LAERYRVVMVEGAGSPAEINLRANDIANMGFAEAVDCPVILVADIDKGGVFAHLVGTLAL
LSASEQARVEGFVINRFRGDIALLEPGLDWLETHTGKPVLGVLPYLHDLHLEAEDAIDDR
QPAKTGERLKVAVAVPPRISNHTDFDPLRLHPQVDLVFVGPGQRIPPADLIVLPGSKSVR
SDLAFLREQGWEAAIRRHLRYGGKLLGICGGLQMLGGRIADPLGLEGAPGESRGLGLLDI
DTVLEAEKQLRNVRGRLALEGAPVSGYEIHAGVSRGAGLDRPALGLDDGRCDGALSEDGQ
VLGTYLHGLFESPAACDALLRWAGLREVASPDYHALRERDIERLADLVEAHLDGARLRAL
CGLSG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaccactctgatggtgcagggcaccacctccgatgccggcaagagcaccctggtgacc
gcgctgtgccgctggctggcgcgccagggcgtggcggtggcgccgttcaagccgcagaac
atggcgctgaacagcgcggtcaccgccgacggcggcgagatcggccgcgcccaggcggtg
caggcccaggcttgcggcctcgccccgcacaccgacatgaacccggtgctgctcaagccc
gacagcgacaccggcgcccaggtgatcgtccacggccgcgccgtcgcctgcatggacgcc
gccgcctaccacgactacaagcgcgtggcccgcgaggcggtgctcgcctcgcaccggcgc
ctcgccgagcgttaccgggtggtgatggtcgagggcgccggttcgccggcggagatcaac
ctgcgcgccaacgacatcgccaacatgggcttcgccgaggcggtcgactgcccggtgatc
ctcgtcgccgacatcgacaagggcggggtgttcgcccatctggtcggcaccctggcgctg
ctctcggcaagcgaacaggcgcgggtcgaggggttcgtgatcaaccgttttcgtggcgat
atcgcgttgctcgagcccggcctcgactggctggagacgcataccggcaaaccggtgctg
ggtgtattgccctatctgcacgatctgcacctggaggccgaggatgccatcgacgatcgc
cagccggccaagaccggcgagcgcttgaaggtggcggtggcggtgccgccgcggatcagc
aaccacaccgacttcgacccgctgcgcctgcacccgcaggtggatctggtcttcgtcggc
cccggccagcgcattccgccggccgacctgatcgtgctgcccggctcgaagagcgtgcgc
agcgacctggccttcctgcgcgagcagggctgggaagcggcgatccgccgccacctgcgc
tacggcggcaagctgctcggcatctgcggcgggctgcagatgctgggcgggcggatcgcc
gatcccctcggcttggagggtgctcccggcgagagccgggggctcggcctgctggatatc
gacaccgtgctggaagccgagaagcaactgcgcaatgtgcgcggacggctggcgctggag
ggcgcgccggtctcgggctacgagatccacgccggcgtcagccgcggcgccggtctcgat
cggccggcgctcgggctcgacgacgggcgctgcgacggcgcgttgagcgaggacggccag
gtgctcggcacctatctgcacggtttgttcgagtcgcccgccgcctgcgacgcgctgctg
cgctgggccggcctgcgcgaggtggccagtcccgactaccacgccctgcgcgagcgcgac
atcgagcgcctggccgatctggtcgaggcgcacctggacggggcgcggttgcgcgcgctg
tgcgggttgtccggatga

DBGET integrated database retrieval system