KEGG   Azotobacter vinelandii CA6: AvCA6_39990Help
Entry
AvCA6_39990       CDS       T02634                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd00561  Glycerolipid metabolism
avd00640  Propanoate metabolism
avd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AvCA6_39990
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AvCA6_39990
Enzymes [BR:avd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     AvCA6_39990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AGK21724
UniProt: M9YMB0
Position
4051911..4053050
Genome map
AA seq 379 aa AA seqDB search
MMPNGAISIRPPGKFFIGKGLLAELGSYAQAFGNRAYVICDKFILERAIAEAGPSFGERG
SAVFGKFRHECTRIEINRNREMARSVKAELIVGIGGGKTLDTAKAVACHERLPVLTVPTT
ASSDAACTARALIYTLSSEFDRCMLLPSAPDLVLADTEILAAAPARLFVAGIGKALATYF
EVRACYRAQAERRVPPRAARTALASARLCLDSLLENAVQARLDVERQRSSRALEAVLEAT
VYLSGVSADGGGRAAAHAIHNGMLAVPALQQARHGEKMAFALLAQLVLERAPQEEIATLL
DFSRAVGLPLGLRELGVRTFAEAQWRRVAERACEKRESMGNMPFAVAPDDVYRAIREADA
LADEHRTASERPPLAVAGG
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgaacggtgcaatctccatccgacctccgggcaagttcttcatcggcaaggga
ctcctggccgagctgggcagttacgcgcaggccttcggcaaccgcgcctacgtcatctgc
gacaagttcatcctcgaacgggcgatcgccgaggccggcccctcgttcggggaacgcggc
tcggcggtgttcggcaagttccgccacgaatgcacgcgcatcgagatcaaccgcaaccgc
gagatggcgcgcagcgtcaaggccgagctgatcgtcggcatcggcggcggcaagaccctg
gacacggccaaggcggtcgcctgccacgaacggctgccggtgctgaccgtgccgaccacc
gcctccagcgacgcggcctgcaccgctcgcgcgctcatctataccctgagcagcgaattc
gaccgctgcatgctcctgccgagcgccccggacctggtcctggccgacaccgagatcctc
gccgcggcgccggcgcggctgttcgtcgccggcatcggcaaggccctggcgacctacttc
gaggtgcgcgcctgctaccgggcgcaggccgaacgccgggtgccgccgcgcgccgcgcgc
accgccctggccagtgcccgcctgtgcctggacagcctgctggaaaacgctgtccaggcc
cgcctcgacgtggagcgccagcgttcgagccgggcactggaggcagtgctggaagcgacc
gtgtacctcagcggggtgagcgccgacggcggcggccgcgccgcggcccacgccatccac
aacggcatgctcgccgtgcccgccctgcagcaggcccgccatggcgagaagatggccttc
gccctgctcgcgcaactggtgctggagcgggcgccgcaggaggaaatcgccacgctgctc
gacttcagccgggccgtcggcctgccgctgggcctgcgcgaactcggcgtcaggaccttc
gccgaggcgcagtggcggcgagtggcggaacgcgcctgcgaaaaacgcgagagcatgggc
aacatgcccttcgcggtcgcgccggacgacgtctaccgggccatccgcgaggccgatgcc
ctggccgacgagcaccggacggccagcgagcgtccgcccctggcggtggccggcggctga

DBGET integrated database retrieval system