KEGG   Azotobacter vinelandii CA6: AvCA6_41120Help
Entry
AvCA6_41120       CDS       T02634                                 

Gene name
ackA-2
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd00430  Taurine and hypotaurine metabolism
avd00620  Pyruvate metabolism
avd00640  Propanoate metabolism
avd00680  Methane metabolism
avd01100  Metabolic pathways
avd01120  Microbial metabolism in diverse environments
avd01200  Carbon metabolism
Module
avd_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:avd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AvCA6_41120 (ackA-2)
   00640 Propanoate metabolism
    AvCA6_41120 (ackA-2)
  09102 Energy metabolism
   00680 Methane metabolism
    AvCA6_41120 (ackA-2)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AvCA6_41120 (ackA-2)
Enzymes [BR:avd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AvCA6_41120 (ackA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AGK17479
UniProt: M9YAC4
Position
4144392..4145591
Genome map
AA seq 399 aa AA seqDB search
MATRNILVLNCGSSSLKFALLSQAHSTPLLAGQAERLAGPQATLHWWQAANIRQRRELPG
ADHRAALQALLPLVEAACGGGLHGIGHRVVHGGEQFTQSCLIDARTLAAIRETVPLAPLH
NPANLLGIETALALFPDLPQVAVFDTAFHQSMPEHAYRYAIPERFYREHGVRRYGFHGTS
HRYVGRRAAEITGLSPGDSCWLSAHLGNGCSTCAIVDGQSRDTSMGLTPLEGLVMGTRSG
DVDPNLHSHLARTLGWSLTEIDHLLNSESGLLGLSGLSNDMRNLEQERARGHRQATLAIE
VFCYRLAKSLAALFCALPRLDGAIFTGGIGENSPLVRARTVAHMGLLGLVVDETANARCV
GGVSGAINAPGHPRLLVIPTNEEQQIALDTLALLDSSAS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcgcaacatactggtgctcaactgcggcagctcgtcgctcaagttcgccctg
ctcagccaggcccactccacgcccctgctcgccggccaggccgagcgcctggccggcccg
caagccacgctgcactggtggcaggcggcgaacatccgccagcgccgcgaactgcccggc
gccgatcaccgcgccgcgctccaggcgctgctgccgctggtcgaggcggcctgcggcgga
ggcctgcacggcatcggccaccgggtggtgcacggcggcgagcagttcacccagtcctgc
ctgatcgacgcgcggacgctcgcggcgatccgcgagacggtaccgctggcgccgctgcac
aacccggccaacctgctcggcatcgagaccgccctggcgctgttccccgacttgccgcag
gtcgcggtgttcgataccgccttccatcagagcatgccggaacacgcctaccgctacgcc
attccggagcgcttctatcgcgagcacggtgtgcgccgctacggcttccacggtaccagc
caccgctacgtcggccggcgcgccgccgagatcaccggcctgtcccccggcgacagttgc
tggctcagcgcccacctgggcaacggctgctcgacctgcgccatcgtcgacggccagagc
cgcgacaccagcatgggcctgaccccgctggaaggcctggtgatgggcacccgcagcggt
gacgtcgaccccaacctgcacagccacctggcccgcaccctgggctggagcctcacggaa
atcgaccacctgctgaacagcgagagcggcctgctcggcctgtccgggctgtccaacgac
atgcgcaacctggagcaggagcgtgcccggggccaccgccaggcgaccctggccatcgag
gtgttctgctaccgcctggccaagtcgctggccgcgctgttctgcgccctgccgcgcctg
gacggggcgatcttcaccggcggcatcggcgagaactcgccgctggtgcgcgccaggacc
gtcgcccacatgggactgctcggcctggtcgtcgacgagaccgccaacgcccgttgcgtc
ggcggcgtcagcggtgcgatcaacgcccccggccatccgcgcctgctggtgatccccacc
aacgaagagcagcagatcgccctggacaccctggcgctgctcgattcctccgcctcctga

DBGET integrated database retrieval system