KEGG   Azotobacter vinelandii CA6: AvCA6_44240Help
Entry
AvCA6_44240       CDS       T02634                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase-like protein
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd00780  Biotin metabolism
avd01100  Metabolic pathways
Module
avd_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:avd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    AvCA6_44240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:avd01007]
    AvCA6_44240
Enzymes [BR:avd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     AvCA6_44240
Amino acid related enzymes [BR:avd01007]
 Aminotransferase (transaminase)
  Class II
   AvCA6_44240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase OKR_DC_1 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGK21995
UniProt: M9YMC9
Position
complement(4477610..4478785)
Genome map
AA seq 391 aa AA seqDB search
MAQARADLMQGRLNPFGTRIDEILSPTEGRIGDHRVILAGTNNYLGLTFDPDCIQAAQQA
LEDQGTGTTGSRMANGSYGSHMALEAELADFFARRSVIVFSTGYMGNLGVIGALAGPEDI
VLLDADCHASIYDACKLGGAQVIRFRHNDAADLERRMRRLGERARTALILVEGIYSMLGD
QAPLREIVEIKQRLGGYLLVDEAHSVGVLGTHGRGLAEELGVEAEVDIVTGTFSKSLGAI
GGFAASHHPDMDLLRCASRPYIFTASPSPSAIASVRAALQALRSRPELRERLWSNARQLY
RGLAALGYRIGPQPSPIVPVLLGSPEEGVAFWENLIERGVYVNLVPPLATPGGQALVRCS
VSAAHTPEQIERIIQAFAALRAPAAKAMAGA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
ttggcgcaggctcgcgccgacctgatgcagggacgtctcaatccgttcggcacgcgcatc
gacgaaatcctttcccccaccgagggacgtatcggcgatcaccgggtgatcctggccggt
accaataactacctggggctgaccttcgaccccgactgcatccaggcggcgcagcaggcg
ctcgaggaccagggaaccgggaccaccggttcgcgcatggccaatggcagctatggcagc
cacatggccctggaggccgaactggccgacttcttcgcgcgccgttcggtgatcgtcttc
tccaccggctacatggggaacctcggcgtcatcggtgccctggccggtccggaggatatc
gtgctgctcgacgcggactgccatgcgagcatctacgatgcctgcaagctgggcggcgcc
caggtcatccgcttccgccacaacgatgcggccgacctggagcggcgcatgcgccggctc
ggcgaacgcgcccgcaccgccctgatcctggtggagggcatctacagcatgctgggcgac
caggcgcccctgcgggagatcgtcgagatcaagcagcgcctgggcggttacctgctggtc
gacgaggcccactcggtcggcgtgctgggcacccatggccgtggcctggccgaggagctg
ggcgtcgaggcggaggtggacatcgtcacgggcaccttcagcaagagcctgggggcgatc
ggcggcttcgcggccagccatcacccggacatggacctgctgcgctgcgcgagccgcccg
tacatcttcaccgcctcgccgtcgccttcggccatcgcctcggtgcgcgccgccctgcag
gcgctgcgcagccgcccggagttgcgcgagcgcctgtggagcaacgcgcggcagctgtac
cgggggctggcggccctgggataccggatcggtccgcagccgagcccgatcgtccccgtg
ctgctgggctcgcccgaggagggcgtggccttctgggagaacctcatcgaacggggtgtg
tacgtgaacctggtgccgcctttggcgactcccggcggccaggcgctggtgcgttgcagc
gtcagcgccgcgcacacgcccgaacagatcgagcgcatcatccaggccttcgccgcgctg
cgagcccccgccgccaaggctatggccggcgcctga

DBGET integrated database retrieval system