KEGG   Azotobacter vinelandii CA6: AvCA6_46840Help
Entry
AvCA6_46840       CDS       T02634                                 

Gene name
apaG
Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
avd  Azotobacter vinelandii CA6
Brite
KEGG Orthology (KO) [BR:avd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AvCA6_46840 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AGK22159
UniProt: M9YNG8
Position
4754378..4754758
Genome map
AA seq 126 aa AA seqDB search
MSDPRYQIDVSVETRYLPEQSQPEQNRYVFAYSVTIRNNGLLPAQLLSRHWLITDGDGHV
QEVRGPGVIGTQPLLGPGQSHNYDSSTLLATQVGTMQGSYQMVAEDGHAFDAPIRPFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatccccgctatcagatcgacgtcagcgtcgagacccgttacctgccggagcag
tcgcagccggagcagaaccgctatgtcttcgcctacagcgtgaccatccgcaacaacggc
ctgctgccggcccaactgctgtcgcgccactggctgatcaccgacggcgacggccatgtc
caggaggttcgcggccccggcgtgatcggcacgcagccgctgctcggcccggggcagagc
cacaactacgacagcagcacgctgctcgccacccaggtcggcaccatgcagggcagctac
cagatggtcgccgaggacgggcacgctttcgacgccccgatccgtccgttccgcctggcc
gtgcccggggccctgcactga

DBGET integrated database retrieval system