KEGG   Azotobacter vinelandii CA6: AvCA6_50200Help
Entry
AvCA6_50200       CDS       T02634                                 

Gene name
maiA
Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
avd  Azotobacter vinelandii CA6
Pathway
avd00350  Tyrosine metabolism
avd00643  Styrene degradation
avd01100  Metabolic pathways
avd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:avd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AvCA6_50200 (maiA)
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    AvCA6_50200 (maiA)
Enzymes [BR:avd01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     AvCA6_50200 (maiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3 Glutaredoxin TetR_C_25
Motif
Other DBs
NCBI-ProteinID: AGK18251
UniProt: M9Y8P1
Position
5088256..5088915
Genome map
AA seq 219 aa AA seqDB search
MTMIRLYSAARSSASFRVRIALNLKGLEYEYVPVDLRGGEQLGAAFRAVNPAALVPVLEI
DGQRLVQSLAILEYLEETRPEPPLLPHEPAARARARAAALAVACDIHPLNNLRVLGYLGR
ELAADESTRNAWYRHWVADGLAQLEAQVRAGGAHGRFIEGDRPSLADLCLIPQIFNAQRF
DARLDHVPLLMGIFDECMALPAFADAQWERQPDFGRSVS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgatccgcctctacagcgccgcccgttcctcggcctcgttccgcgtgcgcatc
gcgctcaacctcaagggtctggaatacgagtacgtgccggtcgacctgcgcggcggcgag
caactcggcgcggccttccgcgccgtcaacccggccgccctggtgccggtgctggagatc
gacggccagcgcctggtgcagtcgctggccatcctcgaatacctggaggaaacccgcccc
gagccgcccctgctgccccacgagccggcggcgcgggcgcgggcgcgggccgccgccctc
gccgtcgcctgcgacatccatccgctcaacaacctgcgcgtgctcggctacctcggtcgc
gagctggcggccgacgagagcacccgcaacgcctggtatcgccactgggtggcggacggc
ctggcccagctcgaagcgcaggtccgcgccggcggcgcccacggccgtttcatcgagggc
gaccggccgagcctggccgacctgtgcctgataccgcagatattcaacgcccagcgcttc
gacgcgcggctcgaccacgtgccgctgctgatgggcatcttcgacgaatgcatggccctg
ccggccttcgccgatgcacagtgggagcggcagccggacttcggccgaagcgtgtcatga

DBGET integrated database retrieval system