KEGG   Archaeoglobus veneficus: Arcve_0515
Entry
Arcve_0515        CDS       T01451                                 

Definition
(GenBank) 3-isopropylmalate dehydratase large subunit
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00290  Valine, leucine and isoleucine biosynthesis
ave00660  C5-Branched dibasic acid metabolism
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01210  2-Oxocarboxylic acid metabolism
ave01230  Biosynthesis of amino acids
Module
ave_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
ave_M00535  Isoleucine biosynthesis, pyruvate => 2-oxobutanoate
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    Arcve_0515
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Arcve_0515
Enzymes [BR:ave01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     Arcve_0515
    4.2.1.35  (R)-2-methylmalate dehydratase
     Arcve_0515
SSDB
Motif
Pfam: Aconitase AcnX DUF3581
Other DBs
NCBI-ProteinID: AEA46542
UniProt: F2KQA9
Position
complement(443625..444872)
AA seq 415 aa
MGKTIAEKIFSEKSGSDAYAGDIVVARIDQIALQDGTAPLAIRSIMEMGLEVRAADRTHF
FVDHAAPSPRKELSNDQKFIREFAEKVGADFNPPGEGIIHQLMVERFIKPGDLAVGADSH
TCTYGALGAFATGMGSTDIAVAVVLGKNWFRVPETFRIEINGRMPKGVYPKDLILTVIGK
LGADGATYKALEFHGETIDGMYMDGRLTMANMAIECGAKAGLFKSDDITKAYLAEMGREN
SFREIKPDEDAEYEKEIHMDADIEPVVAKPHNVDNIASISEVEGVNVDQVFVGTCTNGRL
SDIEIVARMLKGRKVKKGLRLIVAPASRSIYLKALEKGYLKTIVEAGGLIAPPGCACCVG
IHMGILADNEVCVSTQNRNFKGRMGNPNAEIYLASPATAAATAIKGEIADPREFL
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgggcaaaaccattgcagagaagatattcagcgagaaaagtggcagcgatgcttacgct
ggcgatattgttgttgcaaggattgatcagattgctctacaggatggtacagctccgctt
gcgatcaggagcattatggagatgggactcgaagtcagagcagcggacagaacgcacttt
ttcgttgatcatgcagctccctcgccgagaaaagagctcagcaacgaccagaagttcata
agggagtttgcagagaaagttggagctgatttcaatcctccaggcgagggtataattcac
cagctcatggttgagaggttcatcaaaccgggcgatttggctgttggagctgacagtcac
acatgcacctatggcgcacttggagctttcgctacgggcatgggttcaacggatatagcc
gttgccgttgttctgggcaaaaactggttcagagtgcctgaaaccttcagaatcgagata
aatggcaggatgcccaagggcgtttacccgaaagatctcattctgactgttataggcaag
cttggggctgatggggcaacgtacaaagcgctggaattccacggcgagacaattgatggt
atgtacatggatggcagactcacgatggccaacatggcgatagagtgtggagcaaaggcc
gggcttttcaagtcggatgatataacaaaagcctaccttgcagaaatggggagagaaaac
tctttcagagaaataaagcccgatgaagacgcagaatatgagaaggaaatacacatggat
gcggatatagagccggtggttgccaaaccacacaacgttgacaacatcgcttcgatttcc
gaagttgaaggggttaatgtcgaccaggtttttgtcggcacatgcaccaacggcaggctt
tccgatatagagatagttgcaaggatgctgaagggcaggaaagtaaagaagggcttaagg
ctgatagtcgctccggcgagcagaagcatatacctgaaggccctcgaaaagggctatcta
aaaactatcgtcgaggctggcgggctgatcgctcctccaggctgtgcatgctgcgtcgga
atacacatgggaatacttgcagataacgaggtctgcgtttcaacgcagaacaggaacttc
aagggcagaatggggaaccccaacgcagagatatacctcgcctctcccgctaccgctgcc
gctacagcgataaagggagaaatcgccgatccgagagagtttctataa

KEGG   Archaeoglobus veneficus: Arcve_0822
Entry
Arcve_0822        CDS       T01451                                 

Definition
(GenBank) 3-isopropylmalate dehydratase large subunit
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00290  Valine, leucine and isoleucine biosynthesis
ave00660  C5-Branched dibasic acid metabolism
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01210  2-Oxocarboxylic acid metabolism
ave01230  Biosynthesis of amino acids
Module
ave_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
ave_M00535  Isoleucine biosynthesis, pyruvate => 2-oxobutanoate
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    Arcve_0822
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Arcve_0822
Enzymes [BR:ave01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     Arcve_0822
    4.2.1.35  (R)-2-methylmalate dehydratase
     Arcve_0822
SSDB
Motif
Pfam: Aconitase
Other DBs
NCBI-ProteinID: AEA46837
UniProt: F2KRZ6
Position
complement(702493..703749)
AA seq 418 aa
MGKTIAEKILSRAAGKDVKAGDYVLADIDRAMVHDITAPLAIKAFREIAGESAKVWDPSR
IIMAFDHQVPADSVTAAETHKMLRKFAEEQNILNYDVHEGIAHQIMVEKGHAKPGELIVG
ADSHTCMYGALGCFATGIGSTDMGFVFATGKLWFRVPETIRFEVNGKLEKHVYSKDIILK
LIGMVGSDGANYKACEYAGDVVRKMSMAQRLTMSNMAIEMGGKAGIIEPDDETRKYLRAI
GVEDFEEIHGDEDAEAKTVELDVTGMEPQVAKPHRVDNVVGVSEVKGTKVDQVFIGSCTN
GRYEDLKIAAEFLKGEKIAKNVRLIVIPASRAEYRKALKDGLIDIFVEAGGIVEFPCCGP
CMGGSFGLIASGEVSVSTSNRNFIGRQGSPEGKIYLVSPATAAATALYGEITDPREVR
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgggcaaaaccattgcggagaagatactctcaagagctgctggaaaggacgttaaagca
ggagattacgttcttgcggacatagacagggcaatggttcacgatattaccgctcctctt
gccataaaggccttcagggagattgctggcgaaagcgcaaaggtgtgggatccgtcgcgc
ataatcatggcctttgaccatcaggtgccggcagatagcgttactgcagctgagacacac
aaaatgctccgcaaatttgccgaagagcagaacatcctgaactacgatgtgcatgaaggc
attgctcaccagataatggtagaaaaaggtcacgctaagccgggagaactgatagtcgga
gcggacagtcacacgtgcatgtacggagccctcggatgcttcgcaaccggtataggctct
acagacatgggtttcgtcttcgcaaccggcaagctatggttcagggttcctgaaacgata
aggtttgaagttaacggaaaacttgagaagcacgtttacagcaaggacatcattctgaag
ctcataggcatggttggcagcgatggagcaaactacaaggcgtgcgagtatgcaggagac
gtcgtcagaaagatgagcatggctcaacgcctgactatgagcaacatggccatcgaaatg
ggtgggaaagccggcataatagagcctgacgatgaaacgagaaagtacctcagggcaata
ggcgttgaagatttcgaagaaattcacggcgatgaggatgcggaggctaaaactgttgag
ctcgatgtcacgggcatggagccgcaggttgcaaagccacaccgcgttgacaacgtcgtt
ggtgtttcagaagtgaaaggaacgaaggttgaccaggttttcataggttcatgtaccaac
ggcaggtatgaagacctgaaaattgccgccgaattccttaagggggagaaaatcgccaaa
aacgtgaggctcatagttatccccgcgtcaagagcagaatacagaaaagctctcaaagac
gggctgatagatatttttgttgaagcaggtggaattgttgaattcccgtgctgcgggccg
tgcatgggtggaagctttgggctgatagccagtggagaggttagcgtctcaacgtccaac
agaaacttcataggcaggcaggggagcccagaagggaaaatttaccttgtttcacccgcc
acagcagcagcaacagccctctatggcgagattacagacccaagggaggtcaggtag

KEGG   Archaeoglobus veneficus: Arcve_0988
Entry
Arcve_0988        CDS       T01451                                 

Definition
(GenBank) 3-isopropylmalate dehydratase small subunit
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00290  Valine, leucine and isoleucine biosynthesis
ave00660  C5-Branched dibasic acid metabolism
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01210  2-Oxocarboxylic acid metabolism
ave01230  Biosynthesis of amino acids
Module
ave_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
ave_M00535  Isoleucine biosynthesis, pyruvate => 2-oxobutanoate
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    Arcve_0988
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Arcve_0988
Enzymes [BR:ave01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     Arcve_0988
    4.2.1.35  (R)-2-methylmalate dehydratase
     Arcve_0988
SSDB
Motif
Pfam: Aconitase_C Aconitase_2_N
Other DBs
NCBI-ProteinID: AEA46999
UniProt: F2KSV4
Position
complement(845287..845772)
AA seq 161 aa
MGRAWKFGDDIDTDVIIQGKYLVINDPAELAKHVFENVRSEFVKEVKPGDFVVAGENFGC
GSSREHAPLALKATGIEAVIAKSYARIFFRNAINIGLRALECKDADKIDDGDELEVDYSR
NVIVNKTKGEEYPINPLPEFLLQIIEKGGLVGFGKALLKSE
NT seq 486 nt   +upstreamnt  +downstreamnt
atgggcagggcgtggaagtttggcgatgatatagacacggacgttataattcaggggaag
tacctcgtcattaatgatcctgctgaacttgccaagcacgtttttgagaacgttagaagc
gagtttgtcaaggaggtaaaacctggagatttcgtcgtagcgggagagaatttcggatgt
ggaagcagtagagagcatgctcctctcgccttgaaggctactggaattgaggccgttata
gcaaagtcttacgcgagaatattcttcaggaatgcgataaacataggcttaagagcactg
gaatgcaaagatgcggacaaaatagatgatggagacgagctggaagttgactactcgagg
aacgtaattgtgaacaagaccaagggtgaagagtacccgataaacccccttccggagttt
ctgctgcagataatcgagaagggcggactcgtcggtttcgggaaagccctgctgaagtcc
gaataa

KEGG   Archaeoglobus veneficus: Arcve_1257
Entry
Arcve_1257        CDS       T01451                                 

Definition
(GenBank) 3-isopropylmalate dehydratase small subunit
  KO
K01704  3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC:4.2.1.33 4.2.1.35]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00290  Valine, leucine and isoleucine biosynthesis
ave00660  C5-Branched dibasic acid metabolism
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01210  2-Oxocarboxylic acid metabolism
ave01230  Biosynthesis of amino acids
Module
ave_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
ave_M00535  Isoleucine biosynthesis, pyruvate => 2-oxobutanoate
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    Arcve_1257
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Arcve_1257
Enzymes [BR:ave01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     Arcve_1257
    4.2.1.35  (R)-2-methylmalate dehydratase
     Arcve_1257
SSDB
Motif
Pfam: Aconitase_C Aconitase_2_N
Other DBs
NCBI-ProteinID: AEA47264
UniProt: F2KMY8
Position
1109517..1110014
AA seq 165 aa
MILKGRAWKFGDDISTDHITPGRYYHLRSNLPELAKHVMEDANPDFAKLVKPGDFIVAGK
NFGCGSSREHAPRVIKLAGVSAVLAKSFARIFYRNAINIGLPLLIVDTNGIDEGDQLEVN
LSTGEVKNLTKGTSISARPLPDVMIRILQEGGLVNYVKKYGDVRV
NT seq 498 nt   +upstreamnt  +downstreamnt
atgattctcaaaggcagagcgtggaagttcggcgacgatatatcaacagaccatattaca
ccaggaaggtactaccacctcaggagcaatttgcccgaactggcgaagcacgtcatggaa
gacgcgaatcccgactttgcgaagctcgtaaagccgggagatttcatagttgcgggaaag
aactttggatgtggtagcagcagggagcatgcaccgagagttataaagcttgcaggcgtt
tctgccgtgcttgcaaaatccttcgcccgcatattctacaggaatgctataaacattggt
cttccgctgctcattgtcgataccaacggaattgatgaaggcgaccagctcgaagtcaac
ctttcaactggtgaagttaagaatctaacaaaggggacgagcataagcgccagacctctg
cccgatgtgatgataaggatactgcaggagggtgggctcgtaaactacgtaaagaaatac
ggagatgtgagggtttaa

DBGET integrated database retrieval system