KEGG   Archaeoglobus veneficus: Arcve_0797Help
Entry
Arcve_0797        CDS       T01451                                 

Definition
(GenBank) Pyruvate synthase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00010  Glycolysis / Gluconeogenesis
ave00020  Citrate cycle (TCA cycle)
ave00620  Pyruvate metabolism
ave00633  Nitrotoluene degradation
ave00640  Propanoate metabolism
ave00650  Butanoate metabolism
ave00680  Methane metabolism
ave00720  Carbon fixation pathways in prokaryotes
ave01100  Metabolic pathways
ave01120  Microbial metabolism in diverse environments
ave01130  Biosynthesis of antibiotics
ave01200  Carbon metabolism
Module
ave_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcve_0797
   00020 Citrate cycle (TCA cycle)
    Arcve_0797
   00620 Pyruvate metabolism
    Arcve_0797
   00640 Propanoate metabolism
    Arcve_0797
   00650 Butanoate metabolism
    Arcve_0797
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Arcve_0797
   00680 Methane metabolism
    Arcve_0797
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Arcve_0797
Enzymes [BR:ave01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Arcve_0797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AEA46813
UniProt: F2KRX2
Position
complement(682300..683451)
Genome map
AA seq 383 aa AA seqDB search
MKYVVQEGSHSIAEAVALCRPDVIAAFPITPQTHIVERLAELVANGTLDAEFVNVESEHS
ALSLIAGAEACGMRTYTATSSQGLALMHEVLHAVSGMRLPVVMTVANRALSAPLNIWNDH
SDSMSQRDTSWMQFYAESVQEAVDLTIQAYRIAESSDVMLPAMICMDGYVLTHTYEPVIL
PDRALVDEFLPPYEPEYRLDPENPMTFGVYALPSDYMEFKWEQQKAMENAKRRIIRANRE
YRKMFGRTYGNGLIETYNMDGAEVALIAMGSICGTIKEAIEHMNGVGLVRLRTYRPFPFD
ELRNTLKDVETVVVIDRAFSYGFEGPLFSEVKAALYTMDSRPKVCNFVVGLGGRDTRIAD
VEEIVEKAKKLEGGEVVWFKLRA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgtcgttcaggaaggctcgcattccattgctgaggctgttgcgctctgcagg
cctgacgtcattgctgcattccccataacccctcagactcacatcgtggagaggctggca
gaactcgttgcgaacgggactctcgatgcagagttcgttaacgttgagtccgaacattct
gctctatccctcatcgccggagcagaggcgtgcgggatgagaacatataccgccacgtca
tctcaaggcctggctttgatgcacgaggttctgcatgccgtctccggaatgagactgccg
gtggttatgaccgttgcaaacagggctttgagtgccccgctgaacatctggaacgatcac
tccgattccatgtcccagcgggacacatcctggatgcagttctacgcagaatcggttcag
gaagccgtggatctcacgatacaggcttatagaatagcggagagcagcgacgtcatgctg
ccggcgatgatctgcatggatggttatgtcctcacgcatacgtatgagccggtcatcctg
ccagatcgggcgctcgtggatgaattcctgccgccgtacgagcccgagtacaggcttgat
cctgagaatcccatgacgttcggagtctacgctctgccgagtgactacatggagttcaag
tgggaacagcagaaggcaatggagaacgccaagcgacggattatcagagccaacagagag
tacagaaagatgtttggaagaacctacggcaacggtctgattgaaacttacaacatggat
ggcgcagaagtagccctgattgccatgggctccatatgtggtacgataaaggaggcgata
gagcacatgaatggtgttggactcgtaaggctccgcacgtaccgcccgtttccgtttgat
gagctgagaaatacgctgaaagacgttgaaactgtggtggtgatagacagagcattcagt
tacggatttgagggcccgcttttcagcgaagtcaaagctgcattatacacgatggattcc
agaccaaaggtctgcaacttcgtcgtgggcctcggaggaagggatacccgtattgcagac
gtcgaagagattgttgagaaggcaaagaagcttgaaggaggtgaagtcgtgtggttcaag
ttaagggcttaa

DBGET integrated database retrieval system