KEGG   Archaeoglobus veneficus: Arcve_0919
Entry
Arcve_0919        CDS       T01451                                 

Definition
(GenBank) Diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00300  Lysine biosynthesis
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01120  Microbial metabolism in diverse environments
ave01230  Biosynthesis of amino acids
Module
ave_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Arcve_0919
Enzymes [BR:ave01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     Arcve_0919
SSDB
Motif
Pfam: DAP_epimerase Pro_racemase PhzC-PhzF
Other DBs
NCBI-ProteinID: AEA46930
UniProt: F2KSG1
Position
complement(787856..788698)
AA seq 280 aa
MFEGLEFTKMHGNGNDFVVVDEFHEEVVPEEHKPQFVRAVCKPRFGVGADGAIFVQPSSV
ADAKFRYFNSDGSEAAMCGNGIRCFARYVVEEGYADRRFKAETLAGIKELEVSVKDGEYW
VRVDMGKPVFEPAKIPAAGGTFDGVWHDTFELFGRKVDVYAVNTGVPHAVVFVDSLDFDI
LEARKIRYNKAFPEGTNVNFARIVSRNEVEVRTYERGVEDETLSCGTGSVAVVAVASKLG
LIEPEAIVKTKGGVLRIEVRDTAFMTGKATRVFDGVLKEL
NT seq 843 nt   +upstreamnt  +downstreamnt
ttgttcgaaggccttgaatttacaaaaatgcatggcaacgggaacgacttcgttgttgtt
gacgagtttcacgaagaagtcgtaccggaagagcacaagccccagtttgtcagagcagta
tgcaagccgcgcttcggagttggtgcagacggagcaattttcgttcagccttccagcgtt
gctgatgcgaagtttagatacttcaacagcgatggaagcgaggcagcaatgtgtgggaac
ggcatccggtgctttgcccgctacgtcgttgaggaaggttacgctgacaggagattcaaa
gcagagacccttgctggcataaaggagctcgaagtcagcgttaaagacggggagtactgg
gttagagttgacatggggaagcccgttttcgagccagcgaagataccagcagcgggtggg
acgtttgatggagtgtggcacgacaccttcgaactctttggtcggaaagttgatgtttac
gccgtcaacacgggtgtgccccacgcagtcgttttcgtcgattctctcgactttgacatc
ctcgaagcgagaaaaattcgctacaacaaagcatttccagaagggacaaacgttaacttc
gcaagaatagtttcaaggaatgaagttgaggtaagaacgtacgagagaggtgttgaggac
gaaacgctgagctgtggaacggggagcgttgctgttgtagccgtggcgagcaagctcggt
ttaatcgagccagaggcaatagtaaaaacgaagggcggcgttttgaggattgaagttcga
gatactgccttcatgacaggtaaggctacgagggtcttcgacggtgttttgaaggagtta
tga

DBGET integrated database retrieval system