KEGG   Archaeoglobus veneficus: Arcve_1188Help
Entry
Arcve_1188        CDS       T01451                                 

Definition
(GenBank) Phosphoglucosamine mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00010  Glycolysis / Gluconeogenesis
ave00030  Pentose phosphate pathway
ave00051  Fructose and mannose metabolism
ave00052  Galactose metabolism
ave00230  Purine metabolism
ave00500  Starch and sucrose metabolism
ave00520  Amino sugar and nucleotide sugar metabolism
ave00521  Streptomycin biosynthesis
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01120  Microbial metabolism in diverse environments
ave01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcve_1188
   00030 Pentose phosphate pathway
    Arcve_1188
   00051 Fructose and mannose metabolism
    Arcve_1188
   00052 Galactose metabolism
    Arcve_1188
   00500 Starch and sucrose metabolism
    Arcve_1188
   00520 Amino sugar and nucleotide sugar metabolism
    Arcve_1188
  Nucleotide metabolism
   00230 Purine metabolism
    Arcve_1188
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Arcve_1188
Enzymes [BR:ave01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Arcve_1188
    5.4.2.8  phosphomannomutase
     Arcve_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV Borealin
Motif
Other DBs
NCBI-ProteinID: AEA47195
UniProt: F2KMJ8
Position
complement(1045366..1046721)
Genome map
AA seq 451 aa AA seqDB search
MARIGGAGELFGTDGVRGIANEELTVEMALNLGRVMGTIRSGRIAVGMDARISSHMFKSA
VIAGITSTGSDVIDLGLIPTPALQYYVKTNPKITGGIVVTASHNPREYNGIKFIQDDGRE
FTREMDEESERMYKSKTYRIASWQDVGQVYSEDCKRQYIDGIKDKVSVEEIAGKAFKVVV
DCGNGAGCVTTPQLLKELGCTVISINAHPDGRFPARNPEPVEENVEQLKKVVAETNANLG
VAHDGDADRATFVDERGQFVSEDVMLALMAKYYVEKNGGGVVVTPVSSSRCVEDAVREAG
GEIVYTPVGSPVVAETMLKTKAVFGGEGNGGLIFPEHLLARDGAMSAAKVLELMALEGKP
LSELVKDIPRYYTFKTKVPCKDKLKLLNGLKEEFPEASFTDGARIDYEDGWLLIRPSGTE
PIARIFAEGKTEKRAKELLELGMSAVKKILG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaattggtggagctggcgagctttttggcaccgatggcgttcgagggatagcg
aatgaggaactaactgtcgaaatggccctcaaccttggcagagttatgggaacaataaga
agtggtaggattgctgtcggaatggatgcacgcatttcgagccacatgttcaaaagtgct
gtaattgctggcataacttctacaggcagtgatgtcatcgatttagggctcattccaact
ccagcgttgcagtactacgtcaagacgaacccaaaaataacaggcggcattgttgttacc
gcgagccacaatccgagggagtacaacggcataaagttcattcaagacgatggaagggaa
tttacgagggaaatggatgaagagagtgaacggatgtacaagagcaaaacctatcgcata
gcctcctggcaagacgttggccaggtatacagcgaggattgcaaaaggcagtatattgac
ggaattaaggataaagtcagcgttgaagaaatagcaggaaaagcgtttaaagtcgtcgta
gactgcggaaatggggctggatgcgttacgacccctcagcttcttaaagagctcggctgc
acagttattagtataaacgcccatcccgacggacgcttccctgcaagaaatccagaaccg
gtggaggaaaacgtagaacagctcaagaaggttgttgcagaaacgaacgccaatctcggc
gtagcccatgacggtgatgctgacagagcgacgttcgttgacgaaagaggccaatttgtt
agcgaagacgtcatgcttgccctcatggccaagtactacgtggagaagaatggaggaggc
gtcgttgttactcccgtgtcttcgtcacgatgtgtggaggatgccgttagagaggcagga
ggagagatcgtatacactcccgttggctcgccagtggttgcagaaacgatgctgaaaaca
aaggctgtttttggtggagaaggaaacggcgggctgatattccccgagcatctgcttgcg
agagatggagcgatgagtgctgcaaaagtccttgaactcatggcgcttgagggcaaaccg
ctatccgaactcgtgaaagacataccgcgctactacacgtttaagacgaaggttccatgc
aaggataagctcaaactccttaacggattgaaggaggaattcccagaagcgagcttcacc
gacggagcaagaatagactatgaggatggctggctgctgataagaccatcaggaacggaa
cctattgccagaatatttgcagaggggaagactgaaaagagagctaaagaactgctcgag
ctcgggatgagtgccgtaaagaagattctcggctga

DBGET integrated database retrieval system