KEGG   Archaeoglobus veneficus: Arcve_1358
Entry
Arcve_1358        CDS       T01451                                 

Definition
(GenBank) Dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00290  Valine, leucine and isoleucine biosynthesis
ave00770  Pantothenate and CoA biosynthesis
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01210  2-Oxocarboxylic acid metabolism
ave01230  Biosynthesis of amino acids
Module
ave_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Arcve_1358
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Arcve_1358
Enzymes [BR:ave01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     Arcve_1358
SSDB
Motif
Pfam: ILVD_EDD
Other DBs
NCBI-ProteinID: AEA47362
UniProt: F2KNG0
Position
1197535..1199178
AA seq 547 aa
MRSDEIKRGIERTAHRALLKATGLTDEDMDKPFIGVANAYNNIVPGHMLLDRISDAVKEG
IASAGGVAFEFGVIGICDGIAMGHDGMRFALPSRELIADSIEAMVQAHCFDGLVVVGSCD
KIVPGMLMAMLRLDIPAIAVTGGPMLAERIGEKVVTIKTAFEAAGEYKAGRISEEELKLY
EDYCAAYCGSCQGLYTANTMQILTETLGLSLPYCSTSPCGSSRKLRIAKESGKRVVELVK
RGIKPSDIITEESFRNAITMDMLIGGSTNTVLHLPAIAREAGIELSLDVFDEISRKTPHI
VSLDPASEYTIADLDESGGVPMLIQRAKKYFSNELTISGLRIYDIATKAFVRGRDIIREV
TNPIHKEGGIAILYGNLAEKGCVVKAAAVKEDMLRFEGEAKVFDSEQEALKAILNSEVED
GNVVVIRYMGPKGAPGMPEMLLPTAAIAGMGLSRVALITDGRFSGATRGPCIGHISPEAA
VGGNIALVEDGDVISIDIPARRIELKVDNNVLEERRKKWKPKEKKLTGYLARYAKLVSGA
EKGAVFE
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgcgaagtgacgagattaaaagaggaattgaaagaactgctcacagagctcttctcaag
gctactggcctgactgacgaggatatggacaagccattcatcggagttgcaaatgcttac
aacaacatcgttccaggtcacatgctcctcgacaggataagcgatgctgtcaaggaaggt
atcgcctccgctggcggagttgccttcgagtttggagtcataggaatatgcgatggcata
gcgatggggcatgacggcatgcgcttcgctctgccttcgagagagctcatagctgactca
attgaagcgatggttcaggctcactgttttgacgggctggttgttgtgggctcgtgcgat
aagatagtccccggaatgctgatggcaatgctcaggctcgacattcctgcaatagcagtc
acaggcgggccgatgctggcagagagaatcggtgagaaagttgtaacgataaagacagca
tttgaagctgctggagagtataaggctggaaggataagtgaggaagagctcaaactatac
gaagactactgtgccgcttattgtggaagctgccaggggctttacaccgcaaacaccatg
cagattttgaccgagactcttggcttaagtctgccatactgctccacctcgccatgtggc
tcttcgaggaagctcagaatagcaaaggagagtggaaagagagttgttgagctggttaaa
agaggaataaaaccatccgacatcataacagaggagtcgttcagaaatgctataaccatg
gacatgctcattggaggttcaacaaacaccgttctgcatctgccagcaatagcgagagaa
gctgggatagaacttagcctcgatgttttcgacgagataagcaggaaaactccccacatc
gtttcactcgatccagcgagtgagtacaccatcgctgatttggacgagagcggaggagtg
cccatgctgatacagagggctaaaaagtacttcagcaacgagctaacaattagcgggctg
aggatttacgatatagccacaaaggcgtttgtgaggggtagagatataatcagagaagtc
actaatccaattcacaaagagggcggtatagcaattctgtacggtaatttagcggaaaaa
gggtgtgttgtgaaggctgcagccgtcaaagaggacatgcttagatttgagggagaagct
aaggtctttgattcggagcaggaggcattgaaggcaattctaaacagcgaagttgaggat
ggaaacgtggtcgtaataaggtacatggggccgaagggtgctcccggaatgccggaaatg
ctcctgccaacggctgcaatagctggaatggggttgagcagggttgcactcataacggac
ggcaggttcagcggggccacgagggggccgtgcataggccacatttcgcccgaagctgct
gtaggtgggaatattgccctcgtggaagatggagacgtcataagtatcgatatacctgca
aggagaattgagcttaaagttgataataatgtgctggaagaaagaaggaagaagtggaag
ccaaaggagaagaagctgacaggctaccttgcaaggtatgcaaaactcgttagtggggcc
gagaagggggctgtttttgagtga

DBGET integrated database retrieval system