KEGG   Archaeoglobus veneficus: Arcve_1361
Entry
Arcve_1361        CDS       T01451                                 

Definition
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00260  Glycine, serine and threonine metabolism
ave00261  Monobactam biosynthesis
ave00270  Cysteine and methionine metabolism
ave00300  Lysine biosynthesis
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01120  Microbial metabolism in diverse environments
ave01210  2-Oxocarboxylic acid metabolism
ave01230  Biosynthesis of amino acids
Module
ave_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arcve_1361
   00270 Cysteine and methionine metabolism
    Arcve_1361
   00300 Lysine biosynthesis
    Arcve_1361
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Arcve_1361
Enzymes [BR:ave01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     Arcve_1361
SSDB
Motif
Pfam: AA_kinase ACT_7 ACT DUF2007
Other DBs
NCBI-ProteinID: AEA47365
UniProt: F2KNG3
Position
1208062..1209450
AA seq 462 aa
MRIVMKFGGASVKDGNSILHCAKLVKRFSTDNEIVVVVSAMAGVTDSLVHAARKCYTEQS
PGFIKMFIAELAKRHYDAVNTAVAEPHRQRVIAHIDRLIDELEKVLLGISYLGELTRRSE
DYILSFGERLSAPIVSAALLSIGVDSLALTGGDAGIVTNRNFGRAKPIPGVYSIIKSRLE
PLLTIKHTVPVVTGFIGATEDGNITTLGRGGSDLTATLIAAALDADEVWLWKEVDGVLTT
DPKIVPEARVIPEISYQEAMELSHFGAKILHPRALEPVMLKKIPVRIKNTFNPEAPGTVI
SDGCESTKDIVKALSLIEKVAIVNVSGAGFDFAEVMADVFRRLANERVNVIMVSQSSSEL
NLSIVVDESDVGRAMRVLKHMVNGTISISKLEDVAVVSAVGAGMAGTPGVAGRIFSALGK
NGINVIMISQSCSEYNVSFAVSKADGRKAVKILHDEFRLGGS
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgagaatcgtaatgaagttcggcggtgcgagtgtaaaggatggaaacagtatactgcac
tgtgcaaagctcgttaagagattctcgacagacaacgaaatagttgttgtcgtctccgcg
atggcgggagttaccgattctctcgtacatgcagccaggaaatgctatacggagcaatcg
ccgggcttcataaagatgtttattgctgaacttgcgaaaagacattacgatgccgtaaat
acagcagttgctgaaccccacagacagagggttatcgctcacatagaccgccttatcgac
gaacttgaaaaagttctgcttggtataagctatcttggagagctcacaagacgcagtgaa
gattacatactctcatttggtgaaagactgtctgctccaatagtttccgctgcactgcta
tcaataggcgtagattctctcgcattgacgggaggagatgcgggtatagtcaccaacagg
aactttggcagagctaagccgattccgggggtttactcaattataaagagtagactcgag
cccctgctcacgataaagcatacagttcctgttgttacgggcttcataggtgcaacagaa
gacggaaacataaccaccctcggcagaggtggcagcgacttaactgcaacgctcatcgct
gctgcgcttgatgccgacgaggtttggctgtggaaggaagtagatggcgtgctgacaacg
gatccaaagatagtaccggaagcgagagtcattcccgaaatatcgtaccaagaggcaatg
gagctgtcccacttcggggcgaaaattcttcatccgagggctctcgagccggtaatgcta
aagaagatacccgttaggataaagaacacattcaaccccgaagcccctggaacggtcata
tccgacggttgcgagtccacgaaggacatagtcaaggctttaagcttaatagagaaagtt
gcaatcgtcaatgtgagcggagctggttttgacttcgctgaagttatggcagatgtattc
aggaggctcgctaacgaaagagtaaatgtgattatggtgagccagagctcgtccgagctc
aacctgtccatagttgtggacgagagcgacgtgggaagggcgatgagagtgctaaagcac
atggtcaacggaaccataagcatctccaagcttgaagatgtagcggttgtgagtgcagtt
ggagcaggaatggccggaactccaggagttgcaggccgaatcttctcagctcttggcaaa
aacggaataaacgtcatcatgataagccagagctgcagcgagtacaacgtgagctttgca
gtgtcgaaggcagatggaaggaaggccgtaaagattttgcacgacgagttcagacttggg
ggcagctaa

DBGET integrated database retrieval system