KEGG   Archaeoglobus veneficus: Arcve_1366
Entry
Arcve_1366        CDS       T01451                                 

Definition
(GenBank) isopropylmalate/citramalate/homocitratesynthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00290  Valine, leucine and isoleucine biosynthesis
ave00620  Pyruvate metabolism
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01210  2-Oxocarboxylic acid metabolism
ave01230  Biosynthesis of amino acids
Module
ave_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Arcve_1366
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Arcve_1366
Enzymes [BR:ave01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     Arcve_1366
SSDB
Motif
Pfam: HMGL-like LeuA_dimer Mersacidin
Other DBs
NCBI-ProteinID: AEA47370
UniProt: F2KNG8
Position
1216151..1217662
AA seq 503 aa
MRTVSVFDTTLRDGEQTPGVAFPLNYKIQIAKQLDKLGVDVIEAGFPAASKGEFEAVKTI
ANLGLSSKICALARIVKYDIDAALDSEADMVHIFISTSKIQIEHTIQKSREEIVRLAVDA
VEYIKDHGRICMFSAMDATRTEIDYLKQIYKAVEDAGVDIINVPDTVGVATPFKFYDLIK
ELREHLNVPIDVHCHNDFGLAVANTYAAVLAGADEVQVTVNGIGERAGNAALEEVVMTLH
GLEGIKTNIKTEYLVETSKLIERFSGIKVPPNKPIVGANAFSHESGIHAHGVLKDARTFE
PGVITPEMVGHKRRIVIGKHAGRHQIKKILEDAGYQVDEERLTKIMEKVKELGDKGKKVT
DLDLFAIAEVVLGELKKEEKAILVDEVTVLTGNRITPTAVINAEVEGKKKVTSAIGVGPV
DAALNAVKELAGESMRIKLTEFRMDAITGGSDALAEVYVTVEDDEGNSFTARGAGADIVM
ASIEAVIHAVNYLMLMKKKKKHD
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgaggacagtatctgtgtttgacacgacactaagagatggcgagcaaacaccgggggtt
gcgttccccctgaactataagatacagatagcgaagcagctcgacaagctgggtgttgac
gtaattgaagcgggatttcccgcggcctcgaagggtgagttcgaggctgttaagacgatt
gcaaacctcggtttgagttccaagatctgtgctcttgcaagaatcgttaagtacgatatt
gatgctgctttggattccgaagctgatatggttcacatattcatctcaacctcaaagata
cagatagagcacactatccagaaaagtcgggaggagatagtaaggcttgccgtcgatgcg
gtcgaatatattaaagatcacggcagaatctgcatgttctcggcaatggatgctacacga
acagaaatcgattatctcaagcagatttacaaggccgttgaagatgcaggcgttgacata
atcaatgtcccggataccgttggagttgcaactcccttcaagttttacgacctgataaag
gagctcagagagcatctgaatgtccccatcgacgttcactgccacaacgattttggctta
gccgtagcgaacacctatgctgcagttctcgctggagctgatgaagttcaggtaacagtc
aacggaataggtgaaagggctggcaacgcggcgcttgaagaagtcgtcatgactctccac
ggcctcgaaggtataaagaccaacataaaaacggaatatcttgtggagacctcaaagctc
atcgagcgcttctccggcataaaggttccgccgaacaaaccaatagtcggagcgaacgca
ttcagccacgagagtggaatccatgcccatggtgtgctgaaggacgcaagaaccttcgag
ccaggagttataacgccagaaatggtggggcacaagcgcagaatcgtcattggaaagcac
gctggtaggcaccagataaagaagattctggaggatgctggctaccaggtggatgaggaa
aggctgacaaagataatggagaaggtcaaagagctgggagacaagggcaagaaggtgacc
gacctcgatctgtttgccatagcggaagttgtactcggagagctgaagaaggaggagaag
gcaatactcgtcgatgaggttacggtgctgacgggcaacaggattactccgacagctgta
atcaacgcggaagttgaaggaaagaagaaagttacgtctgcaataggtgttgggccggtg
gatgctgcactcaacgctgtcaaggagcttgctggagagagcatgaggattaaactcacg
gagttcagaatggatgccataaccggaggaagtgatgcactcgcagaagtatatgttacg
gtggaggatgacgagggcaactcgttcacagccagaggagcgggagcagacatagtaatg
gcgtctatagaggcagtcatacacgccgtgaactacctcatgctgatgaagaagaaaaag
aagcacgattga

DBGET integrated database retrieval system