KEGG   Archaeoglobus veneficus: Arcve_1393
Entry
Arcve_1393        CDS       T01451                                 

Definition
(GenBank) Ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00290  Valine, leucine and isoleucine biosynthesis
ave00770  Pantothenate and CoA biosynthesis
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01210  2-Oxocarboxylic acid metabolism
ave01230  Biosynthesis of amino acids
Module
ave_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Arcve_1393
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Arcve_1393
Enzymes [BR:ave01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     Arcve_1393
SSDB
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C NAD_binding_2 AdoHcyase_NAD F420_oxidored Oxidored_nitro ApbA
Other DBs
NCBI-ProteinID: AEA47397
UniProt: F2KNS0
Position
1236127..1237131
AA seq 334 aa
MAKIYYDKDADLKLLKDKKVAIIGYGSQGHAHALNLKDSGIDVVIGLYKGSRSWDRAERD
GFTVKEVDEAVSESNVISMLIPDIVQPAVFYREIKNNLKEGDMLLFAHGFNIHYNQIIPP
SYVDVTMVAPKSPGHLVRRMYEEGKGVPALVAVHSDYTGKALDYALAYAKGIGCTRAGVI
ETTFKEETETDLFGEQVDLCGGVAELIKATFETLVEAGYQPEVAYFEALHELKLIVDLIY
EGGIYAMWYSVSDTAKYGGMTRGKRIINESVRQEMRKILKEIQTGEFAREWILENQAARP
VFNKLLEMEKNHPIEKVGKELRKMMPWLRGIEVE
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggcgaaaatttactacgataaagatgccgatttaaagctgctaaaggacaagaaagtc
gccataatcggatatggcagtcagggacacgcgcacgccctcaacctgaaggattccgga
atagacgtcgtcatcgggctgtataagggaagcagaagctgggatagagcagagagagat
gggtttactgttaaggaagtggatgaagccgtgagtgagagcaacgtaatatccatgctc
attcccgacatcgttcagcctgctgttttttacagagagattaaaaacaatctgaaggag
ggcgacatgcttctctttgcccacggcttcaacatccactacaaccagattatcccgccg
agctacgtggatgttacaatggtcgctcccaagagcccgggacacctcgtcaggaggatg
tatgaagaaggcaagggtgttccggctttggttgccgttcacagcgactacacaggtaag
gctcttgactatgcactcgcttatgcaaagggaatcggatgcacgagagcaggcgtaata
gagacaacgtttaaggaggagacagaaactgacctatttggagagcaggttgatctgtgc
ggcggtgttgccgagctaatcaaggcaacattcgaaacgctcgttgaagcgggctaccag
ccagaagttgcctacttcgaagctctgcacgaactgaagctcatagtcgacctcatatac
gagggtggtatctacgcaatgtggtacagcgtaagcgacacggcaaagtacggtgggatg
acgaggggtaagcgcataataaacgagagtgtgaggcaggaaatgagaaaaatcctgaaa
gaaattcagaccggcgagtttgcgagagagtggatactcgaaaatcaggctgcaaggcca
gtcttcaacaagctgctcgagatggagaagaaccatccgatagaaaaggtaggtaaagaa
ctgaggaaaatgatgccctggctcagagggatagaggtcgaatag

DBGET integrated database retrieval system