KEGG   Archaeoglobus veneficus: Arcve_1402Help
Entry
Arcve_1402        CDS       T01451                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00860  Porphyrin and chlorophyll metabolism
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01120  Microbial metabolism in diverse environments
Module
ave_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Arcve_1402
Enzymes [BR:ave01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Arcve_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Sigma70_r1_1 UPRTase Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: AEA47406
UniProt: F2KNS9
Position
1246616..1247401
Genome map
AA seq 261 aa AA seqDB search
MAKENPQNKKVGVSLRVAVFRPKEHIEETAKVLQKEGFEVVAAPFLKTVVSEEGVEKLKK
AEFEVAIITSQTAAKIAAKNIPLQGKRVIAIGKKTASVLSNAGVNSEMPSKFDSKSIVEE
FAEKLRGKKVAILRSDKGDPVLLNLKNYAEVEEIVLYRIEEEHGKEQLEVLEKVARGELD
AAIFSSRMMVHSFMKLADKAGMLKDVIGGLSKMHVIAIGPPTARALKEYDITPLMPEEYT
FEGVMKLLRSLRAERGQQRKQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagagaatccacaaaataaaaaggttggtgtaagcttgagggttgcagtattc
agaccaaaagagcatattgaagaaacggcaaaggttctgcaaaaggagggttttgaggta
gtagcggctccatttctcaaaacggtggtcagtgaggagggtgtcgagaagctgaagaaa
gcagagttcgaagttgcgattataacaagtcagactgctgcaaaaatcgcagcaaaaaac
atacctctgcaggggaagagggtgattgcaataggcaaaaaaacagcatcagttctgagc
aacgctggtgtaaattccgaaatgccttctaagtttgattcaaagagtattgtggaagag
ttcgccgaaaagctgagaggaaagaaggtagccatactcagaagtgacaagggtgacccg
gtcttgctgaacctgaagaactacgctgaggtggaggagatagttctgtacagaatcgag
gaagagcacggcaaagagcagcttgaagttcttgagaaagttgcgaggggagaactcgat
gctgccattttctcgagcagaatgatggtgcacagctttatgaagcttgcagataaagca
ggcatgcttaaagacgtgataggggggctcagcaaaatgcacgtgatagccataggtccg
cccacagcaagagccctgaaagaatacgacattactcctctgatgcccgaagagtacacg
ttcgagggcgtaatgaagctgctccgcagccttagagccgagcgtggccagcagcgaaag
caataa

DBGET integrated database retrieval system