KEGG   Archaeoglobus veneficus: Arcve_1420
Entry
Arcve_1420        CDS       T01451                                 

Definition
(GenBank) acetolactate synthase, large subunit, biosynthetic type
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00290  Valine, leucine and isoleucine biosynthesis
ave00650  Butanoate metabolism
ave00660  C5-Branched dibasic acid metabolism
ave00770  Pantothenate and CoA biosynthesis
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01210  2-Oxocarboxylic acid metabolism
ave01230  Biosynthesis of amino acids
Module
ave_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Arcve_1420
   00660 C5-Branched dibasic acid metabolism
    Arcve_1420
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Arcve_1420
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Arcve_1420
Enzymes [BR:ave01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     Arcve_1420
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C POR_N
Other DBs
NCBI-ProteinID: AEA47423
UniProt: F2KNU6
Position
1263777..1265444
AA seq 555 aa
MRAADALVKALEAEGVEHIFGIPGGAIIEVYDALYDSNIEHILTRHEQAAVHAADGYARA
TGKTGVAFATSGPGATNTVTGIATAYMDSSPLVVMTGQVPRALIGNDAFQEADITGITMP
VTKHNYLVTDPNSLLTTVREAFHIASTGRPGPVLIDLPKDVTMADIEFDYPPKIDLVGYK
PKMKGHPKQIKRAAELIMKSERPVILAGGGVILSNASEELVKLAETIPAFVVTTLMGKGA
MPETHPLCLGFIGMHGSKYANYTIMEADLVIAVGCRFSDRTTGRVSGFAPYAKVVHIDVD
PAEIGKNVRVDVPIVGDAKQVLAELVKYIKYKQRKEWENKVNEWRKTYPLRYKKDGKLRP
QYVIEKVYELKPDAIVTTEVGQNQMWAAQYFKVSRPRQFISSGGLGTMGFGFPAAMGAQV
AFPDKTVVDIAGDGSFLMNIQELATCVDYRIPVKVCILNNMFLGMVRQWQQLFYDERYSA
TCLRCKEMSFEKIAEGFGAVGITVEKETEVEDALKEAFEINDLPVVIDFRVERLENVYPM
VPAGAALNEILDEEV
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgagagctgcagacgcgcttgttaaggctctggaggccgagggtgttgaacacatattc
ggcataccgggaggagcgataatagaggtgtacgacgcgctctatgactcaaatatagag
cacatacttacgaggcacgaacaggctgctgttcacgcagccgatggatatgcaagagct
acgggcaaaacaggagttgcctttgcaacttcaggccccggagcgacaaacacagtcacg
ggcatagcaacggcatacatggactcttcgccgcttgtcgtcatgaccgggcaggttccg
agagcactgattggaaatgacgcttttcaggaagcagacataacgggcataactatgccc
gtaaccaagcacaactacctcgtcactgacccaaattcactgcttacaacagtcagggaa
gcgttccacatcgcttcgactggcaggccaggaccagtgctcatagacctgccgaaggac
gttacaatggcagatatagagttcgactacccgcccaagatagacctcgtcggctacaag
cccaagatgaaggggcatccaaaacagataaaaagagcagcggaactcataatgaagtcc
gagagaccggtaattcttgctggtggtggagttatcctttccaatgcaagcgaagaactc
gtaaagcttgctgaaacaattcctgccttcgtcgtcacaacactgatggggaaaggagca
atgccagaaactcacccgctgtgccttggatttataggaatgcacggttctaagtacgcg
aactacacgataatggaggccgacctcgttattgctgtgggctgccggttcagcgataga
actaccggtagagtttcgggatttgccccttatgcaaaagtcgtacacatagatgtcgat
ccggcggaaattggcaaaaatgtcagggttgatgttccaatcgttggtgatgcgaagcag
gttcttgcagaacttgtgaagtacataaagtacaagcagagaaaggagtgggagaacaag
gtcaatgagtggaggaaaacctatccgctccgctacaaaaaggacggtaaactcaggccg
cagtacgtcatagagaaggtgtacgaactgaagccggatgcaatagtcaccacggaagtt
ggacagaatcagatgtgggctgctcagtacttcaaagtttcaaggccaaggcagttcata
tcgagtggcggtcttggaaccatgggtttcggatttccagcagcaatgggtgcacaggtt
gcatttcccgataaaaccgtcgttgatatagctggggatggtagcttcctgatgaatatt
caggagcttgcaacgtgcgttgactaccgcattcccgtcaaggtctgcatactgaacaat
atgttcctcggaatggtgagacagtggcagcagctattctacgacgaacgctattccgcc
acatgcctgaggtgcaaagagatgagctttgagaagatagcagaaggctttggagctgtt
ggcataacagttgagaaagagacagaggttgaggacgcgctcaaagaggccttcgagatc
aacgacctgccagtggttatagacttcagggtcgaaaggctggagaacgtctatccaatg
gttcctgctggagcagcgctgaacgaaatccttgacgaggaggtgtga

KEGG   Archaeoglobus veneficus: Arcve_1421
Entry
Arcve_1421        CDS       T01451                                 

Definition
(GenBank) acetolactate synthase, small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00290  Valine, leucine and isoleucine biosynthesis
ave00650  Butanoate metabolism
ave00660  C5-Branched dibasic acid metabolism
ave00770  Pantothenate and CoA biosynthesis
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01210  2-Oxocarboxylic acid metabolism
ave01230  Biosynthesis of amino acids
Module
ave_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Arcve_1421
   00660 C5-Branched dibasic acid metabolism
    Arcve_1421
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Arcve_1421
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Arcve_1421
Enzymes [BR:ave01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     Arcve_1421
SSDB
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4 NIL Acylphosphatase Saccharop_dh_N UPF0180 LytR_C ACT_6 APG17
Other DBs
NCBI-ProteinID: AEA47424
UniProt: F2KNU7
Position
1265447..1265941
AA seq 164 aa
MSEKHTIAVLVENKPGVLARVASLFRRRGFNIDSLAVGTTEREDISRMTIVVKGDDRTVE
QVMKQLNKLIEVIKVSDLTTNSVGRELALIKVAATTETRGEIIEIANIFRARIVDVARDS
LIIEITGDEEKINAFIDLMRQYGIKELARTGKISMARGAKVVQI
NT seq 495 nt   +upstreamnt  +downstreamnt
atgagtgagaagcacacaattgccgttctcgttgaaaacaagcccggagttcttgcaagg
gtcgcgtcgctcttcaggcgaaggggtttcaacatcgacagcctcgctgtcggaaccacg
gagagagaggacatctctcgcatgaccatagtcgtcaaaggagatgacagaacggttgag
caggtcatgaagcagctcaacaagctcatagaggtgataaaggtcagtgatttaaccacc
aacagcgttggcagagaacttgctttgataaaagttgccgcaacaaccgagacaaggggt
gagataatcgagatagcaaacatattcagggcaagaatcgttgatgttgcaagagatagc
ctgattatagagattactggcgatgaagagaaaataaatgcattcatcgatttgatgagg
cagtatggaataaaagagcttgcgaggactggcaaaatctcgatggcaagaggagcaaag
gtcgtgcagatatag

DBGET integrated database retrieval system