KEGG   Archaeoglobus veneficus: Arcve_1544Help
Entry
Arcve_1544        CDS       T01451                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00010  Glycolysis / Gluconeogenesis
ave00020  Citrate cycle (TCA cycle)
ave00620  Pyruvate metabolism
ave00633  Nitrotoluene degradation
ave00640  Propanoate metabolism
ave00650  Butanoate metabolism
ave00680  Methane metabolism
ave00720  Carbon fixation pathways in prokaryotes
ave01100  Metabolic pathways
ave01120  Microbial metabolism in diverse environments
ave01130  Biosynthesis of antibiotics
ave01200  Carbon metabolism
Module
ave_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ave00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arcve_1544
   00020 Citrate cycle (TCA cycle)
    Arcve_1544
   00620 Pyruvate metabolism
    Arcve_1544
   00640 Propanoate metabolism
    Arcve_1544
   00650 Butanoate metabolism
    Arcve_1544
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Arcve_1544
   00680 Methane metabolism
    Arcve_1544
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Arcve_1544
Enzymes [BR:ave01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Arcve_1544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_7 Fer4_21 Fer4_2 Fer4_16 Fer4_10 Fer4_9 Fer4_4 Fer4_15 Fer4_13 Fer4_3 Fer4_17 Fer4_11 Fer4_8 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AEA47546
UniProt: F2KPL8
Position
1376937..1377191
Genome map
AA seq 84 aa AA seqDB search
MLKIDCLLAKPSKGSAGKTGLWRTFKPIYNPEKCNHCLLCWLYCPENAIEVNDEEVKIDY
EYCKGCGICAKICPKKALEMEEEE
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
gtgctaaagatagactgcttgctggcaaaaccttcaaaggggtctgcaggcaaaaccgga
ctgtggaggacgttcaaaccaatatacaaccctgaaaaatgcaaccactgtctgctctgc
tggctttactgtcccgaaaacgcaatagaggtcaacgatgaagaggtaaagatcgactat
gagtactgtaagggctgcggaatatgtgcaaagatatgtcccaagaaagcattagaaatg
gaggaggaagaatga

DBGET integrated database retrieval system