KEGG   Archaeoglobus veneficus: Arcve_1585
Entry
Arcve_1585        CDS       T01451                                 

Definition
(GenBank) branched-chain amino acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
ave  Archaeoglobus veneficus
Pathway
ave00270  Cysteine and methionine metabolism
ave00280  Valine, leucine and isoleucine degradation
ave00290  Valine, leucine and isoleucine biosynthesis
ave00770  Pantothenate and CoA biosynthesis
ave01100  Metabolic pathways
ave01110  Biosynthesis of secondary metabolites
ave01210  2-Oxocarboxylic acid metabolism
ave01230  Biosynthesis of amino acids
Module
ave_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ave00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Arcve_1585
   00280 Valine, leucine and isoleucine degradation
    Arcve_1585
   00290 Valine, leucine and isoleucine biosynthesis
    Arcve_1585
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Arcve_1585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ave01007]
    Arcve_1585
Enzymes [BR:ave01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     Arcve_1585
Amino acid related enzymes [BR:ave01007]
 Aminotransferase (transaminase)
  Class IV
   Arcve_1585
SSDB
Motif
Pfam: Aminotran_4
Other DBs
NCBI-ProteinID: AEA47585
UniProt: F2KPQ7
Position
1422377..1423261
AA seq 294 aa
MSSDDLLVYINGEFVPESEAKVSVFDHGFLYGDGVFEGIRAYNGRVFKLKEHIDRLYDCA
KVIDLQIPVTKEEFMDIILETLRRNNLRDAYIRPIVTRGVGDLGLDPRKCSRPMIIVITK
PWGKLYGDLYEKGLKAVTVTVRRNAIDSLPPNIKSLNYLNNILAKIEANAKGGDEAIFLD
HNGYISEGSGDNVFIVKNGAVYTPPTLNNLKGITRAVAIEIIQKLGIPFKETNLGLFDLY
SADEIFVTGTAAEIAPITVIDGRTVGDGKPGEITKRLMDEFRKLTETEGVPIYE
NT seq 885 nt   +upstreamnt  +downstreamnt
atgtccagcgacgatttgcttgtttatattaacggtgagtttgtgccggaaagcgaggcg
aaggtcagcgtttttgaccatggctttctctacggcgacggagtctttgagggcatcagg
gcttataacggcagagttttcaagcttaaggaacacattgatcgtctttacgactgtgca
aaggtgatagacctccagattcccgttacgaaggaagagttcatggacataatccttgaa
actttgaggagaaacaatttgagagacgcgtacataaggccaatcgtaacgagaggtgtt
ggtgacctcggcctcgatccaagaaaatgcagcaggccgatgatcatcgtgataacgaag
ccgtggggcaagctctatggagacctgtacgaaaagggtttgaaggctgtaactgttacc
gtcaggaggaatgcaatcgactcgctcccgccaaacatcaagtctctgaattacctcaac
aacatccttgcgaagatcgaagccaatgctaagggtggtgatgaggcaattttcctcgat
cacaacggctacatctccgaaggcagcggagataacgtgttcatcgtcaaaaatggagca
gtttacactcccccaaccctcaacaacctgaagggaataacgagggccgtggcaatagag
ataattcagaagcttggaataccgttcaaggagacgaacctcggtctgtttgacctttat
tctgcggacgagatattcgttacgggaacggctgctgagatagcaccaataaccgtaatc
gatggcagaactgtaggcgatggaaagcccggagagataacgaaaaggcttatggatgag
ttcagaaaactgacagaaacagaaggagttccgatttacgagtga

DBGET integrated database retrieval system